KEGG   Bos taurus (cow): 539609Help
Entry
539609            CDS       T01008                                 

Gene name
KCNMB3
Definition
(RefSeq) potassium calcium-activated channel subfamily M regulatory beta subunit 3
  KO
K04939  potassium large conductance calcium-activated channel subfamily M beta member 3
Organism
bta  Bos taurus (cow)
Pathway
bta04022  cGMP-PKG signaling pathway
bta04270  Vascular smooth muscle contraction
bta04911  Insulin secretion
Brite
KEGG Orthology (KO) [BR:bta00001]
 Environmental Information Processing
  Signal transduction
   04022 cGMP - PKG signaling pathway
    539609 (KCNMB3)
 Organismal Systems
  Endocrine system
   04911 Insulin secretion
    539609 (KCNMB3)
  Circulatory system
   04270 Vascular smooth muscle contraction
    539609 (KCNMB3)
Ion channels [BR:bta04040]
 Voltage-gated cation channels
  K+ channel, KCNM, KCa1.x
   539609 (KCNMB3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CaKB Cyt_bd_oxida_II tRNA-synt_1g
Motif
Other DBs
NCBI-GeneID: 539609
NCBI-ProteinID: NP_001178213
Ensembl: ENSBTAG00000009235
UniProt: F1MXB6
Position
1
AA seq 283 aa AA seqDB search
MQPFSIPVQITLQGGQRRQGRPAFSTSGTRRNTDHNDGDPPDVHRKLPSSAGEDRAMLLG
FAMMGFSVLMFFVLGVTILKPFLLSTQREESNCTIIHVHTMDDWTDCAFTCGMDCRGQGK
YPCLQLFVKLTHSGQKVLLHYNEEAVQINSKCFYTPKCHQHRNDLLSGALDIKEFFDHKN
GTPFSCFYSPDSQSEDVILIKKYDQMVIFHCLFWPLLTLLGGVLIGGMVRLTQYLSFLCE
KHSTAFRGEVSGKVLHMAQHQFKLWRVGRSKGRSRETLRWWPN
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgcagccgttcagcatccctgttcaaattacactccagggtggccagagacgccagggg
aggccagccttttctacctcagggacgaggagaaacacagaccacaatgatggagaccca
ccagacgtgcacaggaagctaccatccagtgctggagaggaccgggccatgctgctaggg
tttgcaatgatgggtttctcggtcctaatgttcttcgtgcttggagtaaccatcctgaag
cccttcttgctcagcactcagagagaagaatcgaactgcactatcattcatgtgcacacc
atggatgactggacggactgtgcatttacctgtgggatggactgccgaggtcagggcaag
tacccgtgtctccagctatttgtgaagctcacccattcaggtcagaaagtgctcctacat
tataatgaagaggctgtccagataaattccaagtgcttctacacacctaagtgccaccag
catagaaatgatttgctcagtggtgctctggacataaaggaattcttcgatcacaaaaac
gggaccccgttttcatgcttctacagtccagacagccaatccgaagatgtcattctcata
aaaaagtacgaccagatggtgatcttccactgtttattctggcctttgctgaccctgctg
ggtggtgtcctgataggtggcatggtgagattaacacagtacctgtccttcttgtgtgaa
aaacacagcactgcattcagaggtgaggtaagtggcaaagttcttcatatggcccagcat
caattcaaactgtggcgtgttgggaggagcaaaggaaggagcagagaaaccttaagatgg
tggccaaattag

DBGET integrated database retrieval system