KEGG   Bos taurus (cow): 539818Help
Entry
539818            CDS       T01008                                 

Definition
ribophorin I-like
Orthology
K12666  
oligosaccharyltransferase complex subunit alpha (ribophorin I)
Organism
bta  Bos taurus (cow)
Pathway
N-Glycan biosynthesis
Metabolic pathways
Protein processing in endoplasmic reticulum
Module
N-glycosylation by oligosaccharyltransferase
Brite
KEGG Orthology (KO) [BR:bta00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    539818
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    539818
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
8
AA seq 608 aa AA seqDB search
MEAPAVHLLPLLLLFAAWAPEPGSTSAEALPLVNEEVRRTVDLSSHLAKVTAEVVLAHTG
SDSSPRAASFLVALEPEFEAQLAHLGVQVTGVDEEANSLEVQETKINGKSGRFFTVQLPV
ALDPGAEVSVVVEAVYTHAIQPYPIQITQSQKQFVVFEGNNYFYSPYPTKTQTMHVKLAS
PNVESYTKLGNPMRHENLLDYGPFHDIPAYSQDSFKVHSENNSPFLTVTSMTRVIEVSHW
GNIAVEENVNLKHTGAVLKGSFSRYDYDKWIDSGISSIRSFKTILPASAQDVYYRDEIGS
IYTRHLLILDDSVEMEMKPRFPLFGGWKTHYIIGYNLPSYEYLYNLGDQYVLKMRLVDHV
FDKQVIDSLTVKIILPEGARNIQVDSPYEISRAPDKLYYTYLDTFGRPVIVAHKKNLVEQ
HIQDIMVHYTFSKVLMLQEPLLLVATFSILFFTVVIYVRLDLSITKDPAAEARMKVACII
EQVLTLVSKRLGLYHHFNKTVNRYKQSRDVSVLNSGKKSLEMEHKALTSEVALLQARLKT
EGSNLCDKVSEMQKLDTQVKQLVLKSAVEAEWLVAGKLKKDMYIQNKKLISGKRQELVSK
IEHILDTL
NT seq 1827 nt NT seq  +upstreamnt  +downstreamnt
atggaggcgcccgcagtccacctgctgccgttgctgctgctgtttgcggcctgggccccg
gagccaggcagcacctctgcggaggctctgcctctggtcaacgaagaggtgaggcgcacg
gtggacctgagcagccacctggccaaggtgacagccgaggtggtcctggctcacacgggc
agtgactcctcgccccgcgctgcctccttcctggtagcgctggagcctgagttcgaggcc
cagctggcacacctcggcgtgcaggtgacgggagtggatgaggaagccaacagtctggaa
gtacaggagaccaaaattaacggtaaaagcgggagattcttcacagtccaactcccagtt
gctcttgatcctggggccgaggtttcagtcgttgtggaagccgtttatacccacgcgatt
cagccgtatccaatccagatcacccagtctcagaaacagtttgtggtgtttgaggggaac
aattatttttactctccctacccgaccaagacgcaaaccatgcatgtgaagctcgcctcc
ccaaacgtggagagctataccaaattgggcaaccccatgcgccacgagaatctcctggat
tacggccctttccacgacatccctgcctatagtcaggatagttttaaagtacattctgag
aacaacagccctttcctgaccgtcaccagcatgacccgagtcatcgaggtctcccactgg
ggtaatattgctgtggaagaaaacgtgaacctgaagcacacgggggctgtgctgaagggg
tctttttcgcgttatgattatgacaaatggatagatagtggcatctcctccatccgttct
tttaagaccatccttcctgcctctgcccaggatgtttattaccgggatgagattggcagc
atttacaccagacacctccttattttggatgactcggtggagatggaaatgaagcctcgt
ttccctctctttggcgggtggaagactcattacatcattggctacaacctcccaagctat
gagtacctctataatttgggagaccagtatgtgttgaaaatgaggcttgtggaccacgtg
tttgataaacaagtgatagactctctgactgtgaagatcatcctccctgaaggagccagg
aacatccaggtggacagtccctatgagatcagccgagcccccgacaagctatactatacc
tacctggacacatttggccgccctgtgatcgtggcccacaagaaaaacctggtggaacag
catattcaggacatcatggtgcactacaccttcagcaaggtgctcatgctacaggagccc
ctgctgttggtggccaccttctccattctgttcttcaccgtcgtcatctatgtcaggctg
gatttatccatcacaaaggatccagctgcagaagccaggatgaaggtggcttgcataata
gagcaggtcttgaccctggtcagcaagagactaggtctctaccatcactttaacaagaca
gtcaatagatacaaacagtcccgggatgtgtccgtcctcaacagtggcaagaagagcctg
gagatggagcacaaggctttgaccagcgaggtggcactgctgcaggccaggctgaagacc
gagggctccaacctgtgtgacaaagtgagcgaaatgcaaaaactggacacgcaggtcaag
cagctggtcctgaagtcagcagtggaggccgagtggctggtggccggcaagctcaagaaa
gacatgtacatccagaataagaagctcatttcaggaaagcgacaggagctggtcagcaag
attgaacacatcctggataccctgtag

DBGET integrated database retrieval system