KEGG   Bos taurus (cow): 539941Help
Entry
539941            CDS       T01008                                 

Gene name
MAPK8, JNK1
Definition
(RefSeq) mitogen-activated protein kinase 8
  KO
K04440  c-Jun N-terminal kinase [EC:2.7.11.24]
Organism
bta  Bos taurus (cow)
Pathway
bta01522  Endocrine resistance
bta04010  MAPK signaling pathway
bta04012  ErbB signaling pathway
bta04014  Ras signaling pathway
bta04024  cAMP signaling pathway
bta04068  FoxO signaling pathway
bta04071  Sphingolipid signaling pathway
bta04137  Mitophagy - animal
bta04140  Autophagy - animal
bta04141  Protein processing in endoplasmic reticulum
bta04210  Apoptosis
bta04215  Apoptosis - multiple species
bta04217  Necroptosis
bta04310  Wnt signaling pathway
bta04380  Osteoclast differentiation
bta04510  Focal adhesion
bta04530  Tight junction
bta04620  Toll-like receptor signaling pathway
bta04621  NOD-like receptor signaling pathway
bta04622  RIG-I-like receptor signaling pathway
bta04625  C-type lectin receptor signaling pathway
bta04657  IL-17 signaling pathway
bta04658  Th1 and Th2 cell differentiation
bta04659  Th17 cell differentiation
bta04664  Fc epsilon RI signaling pathway
bta04668  TNF signaling pathway
bta04722  Neurotrophin signaling pathway
bta04723  Retrograde endocannabinoid signaling
bta04728  Dopaminergic synapse
bta04750  Inflammatory mediator regulation of TRP channels
bta04910  Insulin signaling pathway
bta04912  GnRH signaling pathway
bta04914  Progesterone-mediated oocyte maturation
bta04917  Prolactin signaling pathway
bta04920  Adipocytokine signaling pathway
bta04926  Relaxin signaling pathway
bta04930  Type II diabetes mellitus
bta04931  Insulin resistance
bta04932  Non-alcoholic fatty liver disease (NAFLD)
bta04933  AGE-RAGE signaling pathway in diabetic complications
bta05132  Salmonella infection
bta05133  Pertussis
bta05142  Chagas disease (American trypanosomiasis)
bta05145  Toxoplasmosis
bta05152  Tuberculosis
bta05160  Hepatitis C
bta05161  Hepatitis B
bta05164  Influenza A
bta05167  Kaposi's sarcoma-associated herpesvirus infection
bta05168  Herpes simplex infection
bta05169  Epstein-Barr virus infection
bta05200  Pathways in cancer
bta05210  Colorectal cancer
bta05212  Pancreatic cancer
bta05231  Choline metabolism in cancer
bta05418  Fluid shear stress and atherosclerosis
Module
bta_M00688  MAPK (JNK) signaling
Brite
KEGG Orthology (KO) [BR:bta00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    539941 (MAPK8)
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    539941 (MAPK8)
   04010 MAPK signaling pathway
    539941 (MAPK8)
   04012 ErbB signaling pathway
    539941 (MAPK8)
   04310 Wnt signaling pathway
    539941 (MAPK8)
   04668 TNF signaling pathway
    539941 (MAPK8)
   04068 FoxO signaling pathway
    539941 (MAPK8)
   04071 Sphingolipid signaling pathway
    539941 (MAPK8)
   04024 cAMP signaling pathway
    539941 (MAPK8)
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    539941 (MAPK8)
   04137 Mitophagy - animal
    539941 (MAPK8)
  Cell growth and death
   04210 Apoptosis
    539941 (MAPK8)
   04215 Apoptosis - multiple species
    539941 (MAPK8)
   04217 Necroptosis
    539941 (MAPK8)
  Cellular community - eukaryotes
   04510 Focal adhesion
    539941 (MAPK8)
   04530 Tight junction
    539941 (MAPK8)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    539941 (MAPK8)
   04621 NOD-like receptor signaling pathway
    539941 (MAPK8)
   04622 RIG-I-like receptor signaling pathway
    539941 (MAPK8)
   04625 C-type lectin receptor signaling pathway
    539941 (MAPK8)
   04658 Th1 and Th2 cell differentiation
    539941 (MAPK8)
   04659 Th17 cell differentiation
    539941 (MAPK8)
   04657 IL-17 signaling pathway
    539941 (MAPK8)
   04664 Fc epsilon RI signaling pathway
    539941 (MAPK8)
  Endocrine system
   04910 Insulin signaling pathway
    539941 (MAPK8)
   04920 Adipocytokine signaling pathway
    539941 (MAPK8)
   04912 GnRH signaling pathway
    539941 (MAPK8)
   04914 Progesterone-mediated oocyte maturation
    539941 (MAPK8)
   04917 Prolactin signaling pathway
    539941 (MAPK8)
   04926 Relaxin signaling pathway
    539941 (MAPK8)
  Nervous system
   04728 Dopaminergic synapse
    539941 (MAPK8)
   04723 Retrograde endocannabinoid signaling
    539941 (MAPK8)
   04722 Neurotrophin signaling pathway
    539941 (MAPK8)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    539941 (MAPK8)
  Development
   04380 Osteoclast differentiation
    539941 (MAPK8)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    539941 (MAPK8)
   05231 Choline metabolism in cancer
    539941 (MAPK8)
   05210 Colorectal cancer
    539941 (MAPK8)
   05212 Pancreatic cancer
    539941 (MAPK8)
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    539941 (MAPK8)
  Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    539941 (MAPK8)
   04932 Non-alcoholic fatty liver disease (NAFLD)
    539941 (MAPK8)
   04931 Insulin resistance
    539941 (MAPK8)
   04933 AGE-RAGE signaling pathway in diabetic complications
    539941 (MAPK8)
  Infectious diseases
   05132 Salmonella infection
    539941 (MAPK8)
   05133 Pertussis
    539941 (MAPK8)
   05152 Tuberculosis
    539941 (MAPK8)
   05164 Influenza A
    539941 (MAPK8)
   05161 Hepatitis B
    539941 (MAPK8)
   05160 Hepatitis C
    539941 (MAPK8)
   05168 Herpes simplex infection
    539941 (MAPK8)
   05167 Kaposi's sarcoma-associated herpesvirus infection
    539941 (MAPK8)
   05169 Epstein-Barr virus infection
    539941 (MAPK8)
   05145 Toxoplasmosis
    539941 (MAPK8)
   05142 Chagas disease (American trypanosomiasis)
    539941 (MAPK8)
  Drug resistance
   01522 Endocrine resistance
    539941 (MAPK8)
Enzymes [BR:bta01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     539941 (MAPK8)
Protein kinases [BR:bta01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   539941 (MAPK8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo Kinase-like RIO1 APH FTA2
Motif
Other DBs
NCBI-GeneID: 539941
NCBI-ProteinID: NP_001179903
BGD-bta: BT10854
Ensembl: ENSBTAG00000007876
Position
28
AA seq 384 aa AA seqDB search
MSRSKRDSNFYSVEIGDSTFTVLKRYQNLKPIGSGAQGIVCAAYDAILERNVAIKKLSRP
FQNQTHAKRAYRELVLMKCVNHKNIIGLLNVFTPQKSLEEFQDVYIVMELMDANLCQVIQ
MELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGTSF
MMTPYVVTRYYRAPEVILGMGYKENVDIWSVGCIMGEMIKGGVLFPGTDHIDQWNKVIEQ
LGTPCPEFMKKLQPTVRTYVENRPKYAGYSFEKLFPDVLFPADSEHNKLKASQARDLLSR
MLVIDASKRISVDEALQHPYINVWYDPSEAEAPPPKIPDKQLDEREHTIEEWKELIYKEV
MDLEERTKNGVIRGQPSPLAQVQQ
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgagcagaagcaagcgtgacagcaatttttatagtgtagagattggagattctacattc
acagtcctgaaacggtatcagaatttaaaacctataggttcaggagcccaaggaatagta
tgtgcagcttatgatgccattcttgaaagaaacgttgcaatcaagaagttaagtcggcca
tttcagaatcaaactcatgctaagcgtgcttacagagagctagttctcatgaaatgtgta
aatcacaaaaatataattggccttttgaatgtttttacaccacagaaatccctagaagaa
tttcaagatgtttacatagtcatggagctcatggatgcaaatctttgtcaagtgattcag
atggagctagatcatgaaagaatgtcctacctgctctatcagatgctgtgtgggatcaag
caccttcactctgctggaattattcaccgggacttaaagcccagtaatatagtagtaaaa
tcagactgcactttgaagattcttgactttggactggccaggactgcaggaactagtttt
atgatgacaccttacgtagtgactcgctactacagagcacctgaggtcatcctaggcatg
ggctacaaagaaaacgttgacatttggtcagttgggtgcatcatgggagaaatgatcaaa
ggtggtgttttgttcccaggtacagatcatattgatcagtggaataaagttattgaacag
cttggaacaccatgtcctgaattcatgaagaaactacaaccaacagtaaggacttatgtt
gaaaacagacctaaatatgccggatatagctttgagaaactcttccctgatgtacttttc
ccagctgactcggaacacaacaaacttaaagccagtcaggcaagggatttgttatccaga
atgctggtaatcgacgcatctaaaaggatttctgtagacgaagctctccagcacccgtat
atcaatgtctggtatgacccttctgaagcagaagctccaccaccaaagatacctgacaag
cagttagatgaaagggaacacacaatagaagagtggaaagaattgatatacaaagaagtt
atggacttggaggagagaaccaagaatggagttatacgggggcagccctctcctttagca
caggtgcagcagtga

DBGET integrated database retrieval system