KEGG   Bos taurus (cow): 539979Help
Entry
539979            CDS       T01008                                 

Gene name
TESK2
Definition
testis-specific kinase 2
Orthology
K08842  
testis-specific kinase 2 [EC:2.7.12.1]
Organism
bta  Bos taurus (cow)
Brite
Enzymes [BR:bta01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     539979 (TESK2)
Protein kinases [BR:bta01001]
 Serine/threonine protein kinases: TKL group
  LISK family [OT]
   539979 (TESK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
3
AA seq 573 aa AA seqDB search
MDRSKRNSIAGFPPRVERLEDFEGGGGGDGNMTQVGRIWPSSYRALISAFSRLTRLDDFT
CEKIGSGFFSEVFKVRHRASGQVMALKMNTLSSNRANMLKEVQLMNRLSHPNILRFMGVC
VHQGQLHALTEYINSGNLEQLLDSNLHLPWTVRVKLAYDIAVGLSYLHFKGIFHRDLTSK
NCLIKRDENGYSAVVADFGLAEKIPDISTGGEKLAVVGSPFWMAPEVLRDEPYNEKADVF
SYGIILCEIIARIQADPDYLPRTENFGLDYDAFQHMVGDCPPDFLQLTFNCCNMDPKLRP
SFVEIGKTLEEILSRLQEEELERDRKLQPTAKGLLEKGPGVKRLSLLDDKIPPKSPRPRR
TIWLSRSQSDIFSNKPPRTVNVLDPYYQPQRVGAARAPKINPFSARQDLKGGKIKFFDLP
SKSVISLVFDLDAPGPGTIPMADWQEPLGPPARRWRSLPSSPEFLHQEACPFVGREESLS
DGPPPRLSSHKYRVREIPPFRASAQPAAPAHEAMDCSNAQEENGFGPRPQGVSPCLAGAP
EEMEVEEERPRDLAPVPFSVSGMGLRTQGEQDG
NT seq 1722 nt NT seq  +upstreamnt  +downstreamnt
atggatcggagcaaacggaattcaattgcaggatttcctccacgtgtggagcgtcttgag
gattttgaaggaggtggtggaggggatgggaacatgacccaagtgggaagaatttggccc
tcctcatatcgagctcttataagtgccttttccagactgacacgtttagatgacttcacc
tgtgaaaaaatagggtctggcttcttctctgaagtgttcaaggtgcgccaccgagcttcc
ggccaggtgatggctcttaagatgaacacgttgagcagtaaccgggcaaacatgctgaaa
gaagtgcagctcatgaatagactctcccatcccaacatccttaggttcatgggtgtgtgt
gtacatcaaggacagttgcatgcactcacagagtatatcaactctggaaacctggaacag
ttgctagacagtaacctgcatttgccctggactgtgagggtgaaactggcttatgacata
gcagtgggcctcagctaccttcacttcaaaggcattttccatcgggacctcacctctaag
aactgcctgataaagagggatgaaaatggttactctgcagtggtagctgactttggcctg
gctgagaagatccctgatatcagcacaggcggtgagaagctagctgtggtgggctcaccc
ttctggatggcacctgaggttctccgagatgagccctacaatgaaaaggcggacgtgttc
tcttatggtatcatcctctgtgagatcatcgcccgcatccaggctgatccagactatctt
ccccgaacagagaatttcgggctagactatgatgctttccagcacatggtgggagactgt
cccccagactttctgcagctcaccttcaactgctgtaatatggaccccaaactacgccca
tcctttgtggagattgggaagaccttggaggaaattctgagccgcctacaggaggaagag
ctggagagagacaggaagctgcagcccacagccaagggactcttggagaaaggacctggg
gtgaagcgactgagcttactggatgacaagataccgcccaagtccccacgcccaagacgt
accatctggctgtctcgaagccagtcagacattttctccaataagcccccacgtacagtg
aacgtcttggatccctactaccagccacaacgagttggtgctgcccgagcccccaaaatc
aaccctttcagtgctcgccaggacctcaaaggtggcaagatcaagttctttgacctgccc
agcaagtctgtcatctccctggtatttgacctggatgcaccagggcctggaacgatcccc
atggctgactggcaggagcccctgggcccacctgctcgccggtggcgttctttgcctagt
tcacctgagttcttgcatcaggaggcttgtccatttgtgggccgggaagaatcactatct
gatgggcccccaccacgcctcagcagtcacaagtacagagtaagggagatcccaccattc
cgagcatctgcccagccagctgctccagcccatgaggccatggactgctccaacgcccag
gaagaaaatggttttgggcccaggccccaaggggtcagtccgtgccttgcaggtgcccct
gaggagatggaagtggaagaagaaaggccaagagacttggctccagtccccttctctgtc
tcaggcatgggcctgaggacccagggagagcaggatgggtga

  All links  
No link information was found.   
DBGET integrated database retrieval system