KEGG   Bos taurus (cow): 539992Help
Entry
539992            CDS       T01008                                 

Gene name
LYPLA1
Definition
lysophospholipase I (EC:3.1.1.5)
Orthology
K06128  
lysophospholipase I [EC:3.1.1.5]
Organism
bta  Bos taurus (cow)
Pathway
Glycerophospholipid metabolism
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:bta00564]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
Ensembl: 
UniProt: 
Position
14
AA seq 230 aa AA seqDB search
MCGNNMSAPLPAIVPAARKATAAVIFLHGLGDTGHGWAEAFAGIRSAHIKYICPHAPVMP
VTLNMNMAMPSWFDIIGLSPDSLEDETGIKQAAENVKALIDQEVKNGIPSNRIILGGFSQ
GGALSLYTALTTQQKLAGVTALSCWLPLRASFPQGPIGGVNRDISILQCHGDLDPLVPLM
FGSLTAEKLKTLVNPANVTFRTYAGMMHSSCQQEMMDIKQFIDKLLPPVD
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggcaataacatgtcggctccgctgcccgccatcgtgcctgccgcccgtaaggcc
accgccgcggtgatcttccttcatggattgggagacacagggcatggatgggcagaagcc
tttgccggaatcagaagcgcccacatcaaatacatctgcccgcatgcgccggttatgcct
gtaacattaaatatgaacatggccatgccatcatggtttgacattattgggctttcgcca
gattcactggaggatgaaactggaattaaacaggcagcagaaaatgttaaagctttgata
gatcaagaggtgaagaacggcattccttctaacagaattattttgggaggattttctcag
ggaggagctttatctctgtacacggctctgaccacacagcagaagctggccggggtcacc
gctctcagctgctggctgccactgcgggcttcgtttccacagggccctatcggtggcgtg
aatagagacatttctattcttcaatgccatggggacctggatcctctagtccccctgatg
ttcggttctctcactgctgagaagctgaagacattggtgaatccagccaatgtgaccttc
agaacctacgcaggcatgatgcacagttcatgtcaacaggaaatgatggacatcaagcag
ttcattgataagctcctacctcctgttgactga

DBGET integrated database retrieval system