KEGG   Bos taurus (cow): 540143Help
Entry
540143            CDS       T01008                                 

Gene name
GK2
Definition
glycerol kinase 2 (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
bta  Bos taurus (cow)
Pathway
Glycerolipid metabolism
Metabolic pathways
PPAR signaling pathway
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:bta00561]
Organismal Systems; Endocrine system; PPAR signaling pathway [PATH:bta03320]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
Ensembl: 
Position
6
AA seq 554 aa AA seqDB search
MAAPKTAAGGPLVGALVQGTDYSNFMVFNSKTSEVLSHHRVELTQEVPKEGWIEQDPKQI
LQSVNECIEKTCEKLQELNIDISNIKAIGVSNQRETTVVWDKLTGEPLYNAVMWLDVRTQ
STVETLSKKIPGNNNFVKSKTGLPLSTYFSAVKLRWILDNVRKAQKAVEEGRALFGTVDS
WLIWSLTGGVDGGIHCTDVTNASRTMLFNIHSLEWDKELCDFFEIPMDILPNIWSSSEIY
GRVKTGTLEGVPISGCLGDQSAALVGQMCFQEGQAKNTYGTGCFLLCNTGHKCVFSECGL
LTTVAYKLGKNKPVFYALEGSVAIGGAVIHWLRDNLGIIKTSEESEKLAKEVGTSYGCYF
IPAFSGLYAPYWEPTARGIICGLTQFTNKSHIAFAALEAICFQTREILDAMNRDCGIPLS
HLQVDGEMTNNKVLMQLQADILHIPVIKASMPETMALGAAMAAGAAEGVNVWSLKPEDLS
TIMMERFEPQIKATESEIRYSTWKKAVMKSMGWVTGQPSESSEANNFSSLPLGFFIVTSM
IMLIGARYISSIFS
NT seq 1665 nt NT seq  +upstreamnt  +downstreamnt
atggcagctccaaagacagcagctgggggtccgttggtgggggctttggtccagggtacg
gactactctaattttatggttttcaattcaaaaacatcagaagtacttagtcaccatcga
gtggaattaacccaagaggtcccaaaagaaggatggatagaacaagaccctaagcaaatt
cttcagtctgttaatgaatgtatagagaaaacgtgtgagaaacttcaagaactgaatatt
gatatatccaacataaaggctataggtgtcagcaatcagagggaaaccaccgtggtctgg
gacaaattaaccggtgagccactctataatgctgtgatgtggcttgatgtaagaacccag
tctactgttgagactcttagtaaaaaaattccaggaaataataacttcgtcaagtccaag
acaggtcttccacttagcacttacttcagcgcagtgaaacttcgttggattcttgacaat
gtgagaaaagctcaaaaggctgttgaagaaggcagagctctttttggtactgttgattca
tggcttatctggagtctgacgggaggagttgatggaggtatccattgcacagatgtaaca
aatgcgagcaggacgatgctcttcaacatccattctttagaatgggataaagagctgtgt
gatttttttgaaattccaatggacattcttccaaatatctggagttcttctgagatctat
ggacgagtgaaaactgggaccctggaaggtgtgccaatatctggatgcttgggggaccag
tctgctgcattagtaggacaaatgtgcttccaggaaggacaagccaaaaacacgtatggg
acaggctgcttcttactatgtaatacaggtcataaatgcgtgttttctgaatgtggcctc
ctgaccacagtggcttacaagctaggcaaaaacaagcccgttttttatgcactggaaggt
tctgtggccataggcggtgctgttattcactggctgagagacaatcttggaattataaaa
acctcagaagaaagtgaaaaacttgctaaagaagtaggtacttcttatggctgctacttc
atcccagccttttcagggttatatgcaccttattgggagcccactgcaagagggatcatc
tgtgggctcactcagttcaccaataagagtcatattgcttttgccgcattggaagctatt
tgtttccaaacccgagagattctggatgccatgaaccgtgactgtggaattccgctcagt
catttgcaggtggatggagaaatgacgaacaacaaagttcttatgcaactgcaagcagac
attctgcatattccagtaataaaagcctccatgcctgaaacaatggcactgggagctgcc
atggcagcaggagctgcagaaggggtgaacgtctggagcctgaaacctgaggatttgtca
accatcatgatggaacggtttgaaccacagatcaaagccacagaaagtgaaattcgttat
tctacatggaagaaagctgtgatgaagtcaatgggttgggttacaggtcagccttctgaa
agtagtgaagctaacaacttctctagtctgcccttgggtttttttatagtgactagcatg
ataatgttaattggagcaagatacatctcaagtatattttcataa

DBGET integrated database retrieval system