KEGG   Bos taurus (cow): 540143Help
Entry
540143            CDS       T01008                                 

Gene name
GK2
Definition
glycerol kinase 2 (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
bta  Bos taurus (cow)
Pathway
Glycerolipid metabolism
Metabolic pathways
PPAR signaling pathway
Brite
KEGG Orthology (KO) [BR:bta00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    540143 (GK2)
 Organismal Systems
  Endocrine system
   03320 PPAR signaling pathway
    540143 (GK2)
Enzymes [BR:bta01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     540143 (GK2)
Exosome [BR:bta04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   540143 (GK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
Ensembl: 
Position
6
AA seq 554 aa AA seqDB search
MAAPKTAAGGPLVGALVQGTDYSNFMVFNSKTSEVLSHHRVELTQEVPKEGWIEQDPKQI
LQSVNECIEKTCEKLQELNIDISNIKAIGVSNQRETTVVWDKLTGEPLYNAVMWLDVRTQ
STVETLSKKIPGNNNFVKSKTGLPLSTYFSAVKLRWILDNVRKAQKAVEEGRALFGTVDS
WLIWSLTGGVDGGIHCTDVTNASRTMLFNIHSLEWDKELCDFFEIPMDILPNIWSSSEIY
GRVKTGTLEGVPISGCLGDQSAALVGQMCFQEGQAKNTYGTGCFLLCNTGHKCVFSECGL
LTTVAYKLGKNKPVFYALEGSVAIGGAVIHWLRDNLGIIKTSEESEKLAKEVGTSYGCYF
IPAFSGLYAPYWEPTARGIICGLTQFTNKSHIAFAALEAICFQTREILDAMNRDCGIPLS
HLQVDGEMTNNKVLMQLQADILHIPVIKASMPETMALGAAMAAGAAEGVNVWSLKPEDLS
TIMMERFEPQIKATESEIRYSTWKKAVMKSMGWVTGQPSESSEANNFSSLPLGFFIVTSM
IMLIGARYISSIFS
NT seq 1665 nt NT seq  +upstreamnt  +downstreamnt
atggcagctccaaagacagcagctgggggtccgttggtgggggctttggtccagggtacg
gactactctaattttatggttttcaattcaaaaacatcagaagtacttagtcaccatcga
gtggaattaacccaagaggtcccaaaagaaggatggatagaacaagaccctaagcaaatt
cttcagtctgttaatgaatgtatagagaaaacgtgtgagaaacttcaagaactgaatatt
gatatatccaacataaaggctataggtgtcagcaatcagagggaaaccaccgtggtctgg
gacaaattaaccggtgagccactctataatgctgtgatgtggcttgatgtaagaacccag
tctactgttgagactcttagtaaaaaaattccaggaaataataacttcgtcaagtccaag
acaggtcttccacttagcacttacttcagcgcagtgaaacttcgttggattcttgacaat
gtgagaaaagctcaaaaggctgttgaagaaggcagagctctttttggtactgttgattca
tggcttatctggagtctgacgggaggagttgatggaggtatccattgcacagatgtaaca
aatgcgagcaggacgatgctcttcaacatccattctttagaatgggataaagagctgtgt
gatttttttgaaattccaatggacattcttccaaatatctggagttcttctgagatctat
ggacgagtgaaaactgggaccctggaaggtgtgccaatatctggatgcttgggggaccag
tctgctgcattagtaggacaaatgtgcttccaggaaggacaagccaaaaacacgtatggg
acaggctgcttcttactatgtaatacaggtcataaatgcgtgttttctgaatgtggcctc
ctgaccacagtggcttacaagctaggcaaaaacaagcccgttttttatgcactggaaggt
tctgtggccataggcggtgctgttattcactggctgagagacaatcttggaattataaaa
acctcagaagaaagtgaaaaacttgctaaagaagtaggtacttcttatggctgctacttc
atcccagccttttcagggttatatgcaccttattgggagcccactgcaagagggatcatc
tgtgggctcactcagttcaccaataagagtcatattgcttttgccgcattggaagctatt
tgtttccaaacccgagagattctggatgccatgaaccgtgactgtggaattccgctcagt
catttgcaggtggatggagaaatgacgaacaacaaagttcttatgcaactgcaagcagac
attctgcatattccagtaataaaagcctccatgcctgaaacaatggcactgggagctgcc
atggcagcaggagctgcagaaggggtgaacgtctggagcctgaaacctgaggatttgtca
accatcatgatggaacggtttgaaccacagatcaaagccacagaaagtgaaattcgttat
tctacatggaagaaagctgtgatgaagtcaatgggttgggttacaggtcagccttctgaa
agtagtgaagctaacaacttctctagtctgcccttgggtttttttatagtgactagcatg
ataatgttaattggagcaagatacatctcaagtatattttcataa

DBGET integrated database retrieval system