KEGG   Bos taurus (cow): 540149Help
Entry
540149            CDS       T01008                                 

Gene name
CYP4B1
Definition
cytochrome P450, family 4, subfamily B, polypeptide 1 (EC:1.14.14.1)
Orthology
K07426  
cytochrome P450, family 4, subfamily B, polypeptide 1 [EC:1.14.14.1]
Organism
bta  Bos taurus (cow)
Brite
Enzymes [BR:bta01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     540149 (CYP4B1)
Cytochrome P450 [BR:bta00199]
 Cytochrome P450, animal type
  CYP4 family
   540149 (CYP4B1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
Ensembl: 
UniProt: 
Position
3
AA seq 511 aa AA seqDB search
MVPVLLSLSLSHLSLWAFALVSVLVFLKLTRLLLRRQMLARAMDRFSGPPTHWLFGHALE
IQQTGSLDKVVSWTHEFPYAHQLWVGQFLGFLNIYDPDYAKAVYSRGDPKAPDFYDFFLQ
WIGKGLLVLQGPKWFQHRKLLTPGFHYDVLKPYVALFAESTRVMLDKWEKKAREQKSFDI
YSDVGHMALDSLMKCTFGKGTSGLNDRDNNYYLSVKELTLLMQQRIDSFQYHNDFIYFLT
PHGRRFLRACQVAHDHTDQVIRERKAALQDEKERERIQSKRHLDFLDILLGAWDEEGIKL
SDEDLRAEVDTFMFEGHDTTTSAISWVLYCMSLYPEHQRRCREEIQEILGDRDTLKWDDL
AEMTYLTMCIKESFRLYPPVPQVYRQLSQPVNFVDGRSLPEGSLISLHIYALHRNSTVWP
DPEVFDPLRFSPENVAGRHSFAFIPFSAGPRNCIGQQFAMAEVKVVTALCLLRFEFSPDP
SRLPIKMPQLVLRSKNGIHLHLKPLGPGSEK
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atggtgcctgttttgctctccctgagtctctcccacctgagcctgtgggcttttgcactg
gtctcagtcttggtcttccttaagctcactcgcctgctgctgcggaggcagatgctagcc
agagctatggacagattctcagggccccccacccactggctttttgggcatgccctggag
atccagcagactgggagtttggacaaggtggtgtcctggactcacgagttcccttacgcc
caccaactctgggttggacaatttcttggcttcctgaacatctatgatcctgactatgcc
aaagctgtgtacagtcgaggagaccctaaggccccagatttctatgacttcttcctccag
tggatagggaaaggcttgctggttctccaagggcctaagtggttccagcatcgcaagctg
ctcacacctggcttccactatgatgtgctgaagccctacgtggccctgtttgctgagtcc
acgcgtgtcatgctggacaagtgggagaaaaaggctcgtgagcaaaagagctttgacatc
tacagcgatgtgggccacatggcgctggactcgctcatgaagtgcacctttggcaaagga
accagcggcctgaatgacagggacaataactactacctgtcggtcaaagaactcacactg
ctgatgcagcagcgcatcgattccttccagtaccacaatgacttcatctactttctcacc
ccacatggccgccgcttcctgcgggcctgccaggtggcccatgaccacacagaccaggtc
atcagggaacggaaagcagccctccaggatgagaaagagcgggagaggatacagagcaag
aggcacctggacttcctggacattctcctgggggcctgggatgaagaaggcatcaagcta
tcagatgaagacctccgggccgaggtggacacattcatgttcgaaggccatgacaccacc
accagcgccatctcatgggttctctactgcatgtccctgtaccccgagcaccagcgtcgt
tgtcgggaagagattcaggagattcttggggaccgggacactttgaagtgggacgatctg
gcagagatgacctacctgaccatgtgcatcaaggagagcttccgcctgtacccgcctgtg
ccccaagtgtaccgccagctcagccagcctgtcaactttgtggatggtcgctctctacct
gaaggcagcctgatttctctgcacatctatgccctccataggaatagtacagtgtggcct
gaccctgaggtcttcgaccccttgcgcttttctcccgagaacgtggccggacgtcacagc
tttgccttcattcccttctctgctgggcccaggaactgcattggccagcagtttgctatg
gccgaggtaaaggtggtcacagccctctgcttgctccgttttgagttttccccggatccc
tcgaggctacccatcaagatgccccaactggtcctacgctccaagaatggcatccacctc
catctgaagccgctggggccaggctctgagaagtag

  All links  
No link information was found.   
DBGET integrated database retrieval system