KEGG   Bos taurus (cow): 540387Help
Entry
540387            CDS       T01008                                 

Gene name
CYSLTR2
Definition
cysteinyl leukotriene receptor 2
Orthology
K04323  
cysteinyl leukotriene receptor 2
Organism
bta  Bos taurus (cow)
Pathway
Calcium signaling pathway
Neuroactive ligand-receptor interaction
Class
Environmental Information Processing; Signal transduction; Calcium signaling pathway [PATH:bta04020]
Environmental Information Processing; Signaling molecules and interaction; Neuroactive ligand-receptor interaction [PATH:bta04080]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
Ensembl: 
UniProt: 
Position
12
AA seq 367 aa AA seqDB search
MERKLVSLSPSISASEMETNSTFSDHHSNRNCTAEDFKREFYPIVYLVIFIWGALGNGFS
IYVFVQPYRKSTSVNIFMLNLATSDLLFTATLPFRVDYYLRGSNWIFGDLSCRIMSYSMY
VNMYSSIYFLTVLSVVRFLATVHPFRLLHATSVRNAWIVCGIIWIFIMASSTTLLNNGSE
LKGNVTLCLELNRNKAPKLKTMNYIALVVGFLLPFCTLSICYMLIIRALLKAEVPELGLR
LSHRKALTTIIIALVIFLLCFLPYHILRTLHLLQWTADICRDSLHKAVAITLALAAANSC
FNPLLYYFAGENFKDRLKSALRKDHPQEPKCSFPFCVWLKNETRGTLQESLLLQNKRINQ
DKGKHDI
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atggaaagaaaacttgtgtccttatctccatccatatccgcatcagaaatggaaaccaac
agcaccttcagcgatcaccatagcaacaggaactgcacagctgaagactttaagagagaa
ttttaccccatcgtgtacctggtaatatttatctggggagccttgggaaatggcttttcc
atatatgttttcgtgcaaccttataggaagtccacatctgtgaacattttcatgctcaat
ctggctacttcagatctcttattcacagccacactgcccttcagggtggactattacctc
agagggtccaattggatatttggggacctgagttgcaggattatgtcttactctatgtat
gtcaacatgtacagcagcatttatttcctgactgtgttgagtgtggtgcgtttcctggca
accgttcaccccttccggctccttcatgccactagcgtcaggaatgcctggattgtttgt
ggcatcatatggatctttatcatggcttcctcaacaacgcttctgaacaatggctctgag
ctgaagggcaatgtcacgttgtgcttggagctgaatcgtaataaagctcctaaactgaag
accatgaactacattgccttggtggtgggctttctgctgcccttctgcacactcagcatc
tgctacatgctgatcattcgagctctgttgaaggcggaggtcccagaattagggctgcgg
ctttctcacaggaaggcattgaccaccatcatcattgccttggtcatcttcctcctgtgt
ttcttgccctatcatatactgagaaccctccacctgctccagtggacggcggatatatgc
agagactcgctgcataaagctgtggccatcacactggctttggcggcagccaacagctgc
ttcaaccctttgctttattactttgctggggagaattttaaggacagactaaagtctgca
ctcaggaaagatcatccacaggaaccaaagtgcagctttcctttctgtgtgtggctgaaa
aacgaaacaagaggaaccctacaggagagtttgcttctccaaaataagagaataaaccaa
gataaaggaaaacatgacatctag

DBGET integrated database retrieval system