KEGG   Bos taurus (cow): 540404Help
Entry
540404            CDS       T01008                                 

Gene name
PRKAA1
Definition
protein kinase, AMP-activated, alpha 1 catalytic subunit (EC:2.7.1.-)
Orthology
K07198  
5'-AMP-activated protein kinase, catalytic alpha subunit [EC:2.7.11.11]
Organism
bta  Bos taurus (cow)
Pathway
FoxO signaling pathway
Regulation of autophagy
mTOR signaling pathway
PI3K-Akt signaling pathway
Circadian rhythm
Insulin signaling pathway
Adipocytokine signaling pathway
Oxytocin signaling pathway
Non-alcoholic fatty liver disease (NAFLD)
Hypertrophic cardiomyopathy (HCM)
Class
Environmental Information Processing; Signal transduction; FoxO signaling pathway [PATH:bta04068]
Environmental Information Processing; Signal transduction; PI3K-Akt signaling pathway [PATH:bta04151]
Environmental Information Processing; Signal transduction; mTOR signaling pathway [PATH:bta04150]
Cellular Processes; Transport and catabolism; Regulation of autophagy [PATH:bta04140]
Organismal Systems; Endocrine system; Insulin signaling pathway [PATH:bta04910]
Organismal Systems; Endocrine system; Adipocytokine signaling pathway [PATH:bta04920]
Organismal Systems; Endocrine system; Oxytocin signaling pathway [PATH:bta04921]
Organismal Systems; Environmental adaptation; Circadian rhythm [PATH:bta04710]
Human Diseases; Cardiovascular diseases; Hypertrophic cardiomyopathy (HCM) [PATH:bta05410]
Human Diseases; Endocrine and metabolic diseases; Non-alcoholic fatty liver disease (NAFLD) [PATH:bta04932]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
20
AA seq 458 aa AA seqDB search
MVMEYVSGGELFDYICKNGRLDEKESRRLFQQILSGVDYCHRHMVVHRDLKPENVLLDAH
MNAKIADFGLSNMMSDGEFLRTSCGSPNYAAPEVISGRLYAGPEVDIWSSGVILYALLCG
TLPFDDDHVPTLFKKICDGIFYTPQYLNPSVISLLKHMLQVDPMKRATIKDIREHEWFKQ
DLPKYLFPEDPSYSSTMIDDEALKEVCEKFECSEEEVLSCLYNRNHQDPLAVAYHLIIDN
RRIMNEAKDFYLATSPPDSFLDDHHLTRPHPERVPFLVAETPRARHTLDELNPQKSKHQG
VRKAKWHLGIRSQSRPNDIMAEVCRAIKQLDYEWKVVNPYYLRVRRKNPVTSTYSKMSLQ
LYQVDSRTYLLDFRSIDDEITEAKSGTATPQRSGSVSNYRACQRNDSDAEAQGKSSEASL
TSSVTSLDSSPVELTPRPGSHTIEFFEMCANLIKILAQ
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atggtgatggaatatgtctcaggaggagagctatttgattatatctgtaaaaatggaagg
ctggatgaaaaagaaagtcgacgactgttccaacaaatcctttctggtgtggattactgt
cacaggcatatggtggtccacagagatttgaaacctgaaaacgtcctgcttgatgcacac
atgaatgcaaagatagctgattttggtctttcaaacatgatgtcagatggtgaattttta
agaacaagttgtggctcacccaactatgctgcaccagaagtaatttcaggaagattgtat
gctggtccagaggtagatatatggagcagtggggttattctgtatgctttattatgtgga
acccttccgtttgatgatgatcacgtgccaactctttttaagaagatatgtgatgggatc
ttttatacccctcaatatttaaatccttctgtgattagccttttgaaacatatgctgcag
gtggatcccatgaagagagccacaatcaaagatatcagggaacatgaatggtttaaacag
gaccttccaaaatatctctttcctgaggatccatcatatagctcaaccatgattgatgat
gaagccttaaaagaagtatgtgaaaaatttgaatgctcagaggaggaggttctcagctgc
ctttataacagaaatcaccaggaccctttggcagttgcctaccacctcataatagataac
aggaggataatgaacgaggccaaagatttttacttggcaacgagcccaccagattcgttt
ctcgacgatcaccacttgactcggccccatcctgaaagagtaccattcttggttgctgaa
actcccagggcgcgccatacccttgatgaattaaatccacagaaatccaaacaccaaggt
gtaaggaaagcaaaatggcatttgggaattagaagtcaaagtcggccaaatgatatcatg
gcagaagtttgtagagcaattaaacagctggattatgaatggaaggttgtaaacccgtat
tatttgcgtgttcggaggaagaatcctgtgacaagtacatactccaaaatgagtctgcag
ttataccaagtggatagtagaacgtatttactggatttccgaagtattgatgatgaaatt
actgaagccaaatcagggactgctacgccacagagatcgggctcagttagcaactatcga
gcttgccaaaggaatgattcagatgctgaggctcaaggaaaatcctcagaagcttctctt
acctcatctgtaacctcacttgactcttctcctgttgaattaactccaagacctggaagt
cacacaatagaattttttgagatgtgcgcgaatctaattaaaattcttgcacagtaa

DBGET integrated database retrieval system