KEGG   Bos taurus (cow): 540660Help
Entry
540660            CDS       T01008                                 

Gene name
CDC27
Definition
(RefSeq) cell division cycle 27
  KO
K03350  anaphase-promoting complex subunit 3
Organism
bta  Bos taurus (cow)
Pathway
bta04110  Cell cycle
bta04114  Oocyte meiosis
bta04120  Ubiquitin mediated proteolysis
bta04914  Progesterone-mediated oocyte maturation
bta05166  HTLV-I infection
Module
bta_M00389  APC/C complex
Brite
KEGG Orthology (KO) [BR:bta00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    540660 (CDC27)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    540660 (CDC27)
   04114 Oocyte meiosis
    540660 (CDC27)
 Organismal Systems
  Endocrine system
   04914 Progesterone-mediated oocyte maturation
    540660 (CDC27)
 Human Diseases
  Infectious diseases
   05166 HTLV-I infection
    540660 (CDC27)
Protein phosphatases and associated proteins [BR:bta01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     540660 (CDC27)
Ubiquitin system [BR:bta04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Other subunits
     540660 (CDC27)
Chromosome and associated proteins [BR:bta03036]
 Eukaryotic Type
  Sister chromatid separation proteins
   APC/C complex
    540660 (CDC27)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TPR_1 TPR_2 ANAPC3 TPR_8 TPR_12 TPR_11 TPR_17 TPR_16 TPR_19 TPR_14 TPR_6 TPR_9 ChAPs TPR_20 TPR_21 Cas_Cas02710
Motif
Other DBs
NCBI-GeneID: 540660
NCBI-ProteinID: NP_001098898
BGD-bta: BT13848
Ensembl: ENSBTAG00000002726
UniProt: A7Z061
Position
19
AA seq 825 aa AA seqDB search
MTVLQEPVQAAIWQALNHYAYRDAVFLAERLYAEVHSEEALFLLATCYYRSGKAYKAYRL
LKGHSCTTPQCKYLLAKCCVDLSKLAEGEQILSGGVFNKQKSHDDIVTEFGDSACFTLSL
LGHVYCKTDRLAKGSECYQKSLSLNPFLWSPFESLCEIGEKPDPDQTFKLTSLQNFSSCL
PNSCTTLVSNHSLSHRQPETVLTETPQDTIELNRLNLESSNSKYSLNTDSSVSYIDSAVI
SPDTVPLGTGTSILSKQVQNKPKTGRSLLGGPAALSPLTPSFGILPLETPSPGDGSYLQN
YTNTSSVIDVPPTGAPSKKSVARIGQTGTKSVFSQSGNSREVTPILVAQTQSSGPQTSTT
PQVLSPTITSPPNALPRRSSRLFTSDSSTTKENSKKLKMKFPPKIPNRKTKSKTNKGGIT
QPNINDSLEITKLDSSIISEGKISTITPQIQAFNLQKAAAEGLMSLLREMGKGYLALCSY
NCKEAINILSHLPSHHYNTGWVLCQIGRAYFELSEYMQAERIFSEVRRIENYRVEGMEIY
STTLWHLQKDVALSVLSKDLTDMDKNSPEAWCAAGNCFSLQREHDIAIKFFQRAIQVDPN
YAYAYTLLGHEFVLTEELDKALACFRNAIRVNPRHYNAWYGLGMIYYKQEKFSLAEMHFQ
KALDINPQSSVLLCHIGVVQHALKKSEKALDTLNKAIVIDPKNPLCKFHRASVLFANEKY
KSALQELEELKQIVPKESLVYFLIGKVYKKLGQTHLALMNFSWAMDLDPKGANNQIKEAI
DKRYLPDDEEPITQEEQIMGTDESQESSMTDADDTQLHAAESDEF
NT seq 2478 nt NT seq  +upstreamnt  +downstreamnt
atgacggtgctgcaggaacccgtccaggctgctatatggcaagcactaaaccactatgct
tacagagatgcagttttcctagcagagcgactgtatgcagaagtacactcagaagaagcc
ttgtttttactggcaacctgttattaccgctcaggaaaagcatataaagcatatagactt
ttgaaaggacacagttgtactacaccgcaatgtaaatacctgcttgcaaaatgttgtgtt
gatctcagcaagcttgcagaaggggaacagatcttatctggtggagtgtttaataagcag
aaaagccatgatgatattgttactgagtttggtgattcagcttgctttactctttcattg
ttgggacatgtatattgcaagacagatcggcttgccaaaggatcagaatgttaccaaaag
agccttagtttaaatcctttcctctggtccccctttgaatcattatgtgaaataggtgaa
aagccagatcctgaccaaacatttaaattaacgtctttacagaactttagcagctgtctg
cccaactcttgcacaacactagtatctaatcatagtttatctcacagacagcctgagaca
gttcttacagaaacaccccaggacacaattgaattaaacagactgaatttagaatcttcc
aattcaaagtactcgttgaatacagattcttcggtgtcttatattgattcggctgtaatt
tcaccagatactgtccctcttggaacaggaacttccatattatctaaacaggttcaaaat
aaaccaaaaactggtcgaagtttattaggaggaccagctgctcttagcccattaacccca
agttttgggattttgccattagaaaccccaagtcctggagatggatcctatttacaaaac
tacactaatacatcttctgtaattgacgtgccacccaccggagccccttcaaaaaagtct
gttgccagaatcggccaaactggaacaaagtctgtcttctcacagagtggaaacagtcga
gaggtaactccaattcttgttgcacagacacaaagttctggcccacaaacaagtaccaca
cctcaggtattgagccccactatcacatctcccccaaatgcactgcctcgaagaagttct
cgactttttactagtgacagctctacaaccaaggagaatagcaaaaaattaaaaatgaag
tttccacctaaaatcccaaacagaaaaacaaaaagtaaaactaataaaggaggaataact
caacctaacataaatgatagcctggaaatcacaaaattagattcttcaatcatttcagaa
ggaaaaatctctacaattacacctcagatccaggcatttaatctacagaaagcagcagca
gaaggtttgatgagccttcttcgtgaaatgggaaaaggttatttagctttgtgttcatac
aactgcaaagaagctattaatatcttgagccacctaccttctcaccactacaatactggt
tgggtgctgtgccaaattggaagggcctatttcgaactttcagagtacatgcaagctgaa
agaatattctcagaggttaggagaattgagaattacagagtcgaaggcatggagatctac
tctacaacactttggcatcttcaaaaggatgttgctctttcagttctttcaaaagactta
acagatatggataaaaattcaccagaggcctggtgtgctgcagggaactgtttcagtttg
cagcgggaacatgatattgcaattaaattcttccagagagctatccaggttgatccaaat
tatgcttatgcctatactctattagggcacgagtttgtgttaactgaagaattagacaaa
gcattagcttgttttcgaaatgctatcagagtcaatcctagacattataatgcatggtat
ggtttaggaatgatttattacaagcaagaaaaattcagccttgcagaaatgcatttccag
aaagcacttgacatcaaccctcaaagttcagttttgctttgccacattggagtagttcag
catgcactgaaaaaatctgagaaggctttggataccctaaacaaagccattgttattgat
cctaagaaccctctatgcaaatttcacagagcctcagttttatttgcaaatgaaaaatat
aagtctgctttacaagaacttgaagaattgaaacaaattgttcccaaagaatccctcgtt
tacttcttaataggaaaggtttacaagaagttaggtcaaacgcacctcgccctgatgaat
ttctcttgggctatggatttagatcctaaaggagccaataaccagattaaagaggcaatt
gataaacgctaccttccagatgatgaggagccaataacccaagaagaacagatcatggga
acagatgaatcccaggagagcagcatgacggatgctgatgacacacaacttcatgcagct
gaaagtgatgaattttaa

DBGET integrated database retrieval system