KEGG   Bos taurus (cow): 540666Help
Entry
540666            CDS       T01008                                 

Gene name
HDAC8
Definition
histone deacetylase 8 (EC:3.5.1.98)
Orthology
K11405  
histone deacetylase 8 [EC:3.5.1.98]
Organism
bta  Bos taurus (cow)
Pathway
Alcoholism
Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:bta00001]
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    540666 (HDAC8)
  Substance dependence
   05034 Alcoholism
    540666 (HDAC8)
Enzymes [BR:bta01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     540666 (HDAC8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
X
AA seq 377 aa AA seqDB search
MEESEEPADAGQSLPPVYIYSPEYVSVCDSLAKVPKRASMVHSLIEAYALHKQMRIVKPK
VASMEEMASFHTDAYLQHLQKVSEDGDDDHPDSIEYGLGYDCPATEGIFDYAAAVGGATI
TAAQCLIDGMCKVAINWSGGWHHAKKDEASGFCYLNDAVLGILRLRRKFDRILYVDLDLH
HGDGVEDAFSFTSKVMTVSLHKFSPGFFPGTGDVSDVGLGKGRYYSVNVPIQDCIQDERY
YHICESVLKEVYIAFNPKAVVLQLGADTIAGDPMCSFNMTPVGIGKCLKYILQWELATLI
LGGGGYNLANTARCWTYLTGVILGKTLSSEIPDHEFFTAYGPDYVLEITPSCRPDRNEPH
RVQQILNYIKGNLKHVV
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atggaggaatcggaggaaccggcggacgctgggcagtcgctgcccccagtttacatttac
agtcccgagtatgttagcgtgtgcgactccctggccaaagtccccaaacgggccagtatg
gtacattccttgattgaagcatatgcactgcataagcaaatgaggatagttaagcccaaa
gtggcctccatggaggagatggccagcttccataccgatgcctatctgcagcatctccag
aaggttagcgaagatggagatgatgatcatccagactccatagaatatggactaggttat
gactgcccagccactgaaggaatattcgactatgcagcagctgtaggaggggctacaatc
acagctgcccagtgcctgattgatggaatgtgcaaagtagcaatcaactggtctggaggg
tggcatcatgcaaagaaagatgaagcatctggtttttgttatctcaatgatgctgtcctg
ggaatattacggttgcgacggaaatttgaccgtattctctatgtggatttggatctgcac
catggagatggtgtagaagatgccttcagtttcacctccaaagtcatgacggtgtccctg
cacaaattctctccaggatttttcccaggaacaggtgatgtgtctgatgttggcctaggg
aagggacggtactacagtgtaaacgtgcccattcaggattgcatacaggatgagaggtat
taccacatctgtgaaagtgtactaaaggaagtgtacatagcctttaatcccaaagcagtg
gtcttacagctgggagctgatacaatagctggggatcccatgtgctcctttaacatgact
ccagttggaattggcaaatgtcttaagtacatccttcaatgggagttggcaacgctcatc
ttgggaggaggaggctataaccttgccaacacggctcgatgctggacatacttgaccggg
gtcatcctagggaaaacactatcctctgagatcccagatcatgagtttttcacagcatat
ggtcctgattatgtgctggaaatcacgccaagctgccggccagaccgcaatgagccccac
cgagtccagcaaatcctcaactacatcaaagggaatctgaagcatgtggtctag

DBGET integrated database retrieval system