KEGG   Bos taurus (cow): 540707Help
Entry
540707            CDS       T01008                                 

Gene name
CYP2A13
Definition
cytochrome P450, family 2, subfamily A, polypeptide 13-like
Orthology
K17685  
cytochrome P450, family 2, subfamily A, polypeptide 13 [EC:1.14.14.1]
Organism
bta  Bos taurus (cow)
Pathway
Metabolism of xenobiotics by cytochrome P450
Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:bta00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    540707 (CYP2A13)
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    540707 (CYP2A13)
Enzymes [BR:bta01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     540707 (CYP2A13)
Cytochrome P450 [BR:bta00199]
 Cytochrome P450, animal type
  CYP2 family
   540707 (CYP2A13)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
18
AA seq 450 aa AA seqDB search
MLASGLLLVALLACLTIMVLMSVWRQRNLKGKLPPGPTPLPFIGNYLQLNTEQMCNSLMK
ISEHYGPVFTVHLGTRQIVVLCGYDAVKEALVDQAEEFSGRGKQATFDWLFKGYGVAFSN
GERAKQLRRFSITTLRDFGVGKRGIEERIQEEAGFLIEAFRGTRGAFIDPTFFLSRTVSN
VISSIVFGDRFDYEDKEFLSLLRMMLGSFQFTATSTGQLYEMFYSVMKYLPGPQQQAFKE
LQGLEDFIAKKVEQNQRTLDPNSPRDFIDSFLIRMQEEKENPNTEFYRKNLVMTTLNLFF
AGTETVSTTMRYGFLLLMKHPDVEAKIHEEIDRVIGKNRQPKFEDRAKMPYTEAVIHEIQ
RFGDMIPMGLARRVTKDTKFRDFLLPKGTEVFPMLGSVLRDPKFFSNPRDFNPQHFLDEK
GQFKKSDAFVPFSIGKRHCQLNTHRGLLYL
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atgctggcctcagggctgctcctcgtggctttgctggcctgtctgactatcatggtcttg
atgtctgtctggcggcaaaggaacctcaaagggaaattgcctccagggcccactcctctg
cccttcatcgggaactacctgcagctgaacaccgagcagatgtgcaactccctcatgaag
atcagcgagcactacggccctgtgttcacggtccacctggggacccggcagattgtggtg
ctgtgtggctatgatgctgtgaaggaggctctggtggaccaggctgaagaattcagtggg
cgaggcaagcaggctacctttgactggctcttcaaaggctatggcgtggcgttcagcaac
ggggagcgcgccaagcagctccggcgcttctcgattacaactctgcgggacttcggcgtg
ggcaagcgcggcatcgaagagcgcatccaggaggaggcgggcttcctcatcgaggccttc
cggggcactcgcggcgccttcatcgatcccaccttcttcctgagccgaacggtctccaat
gtcatcagctccattgtcttcggggaccgctttgactacgaggacaaagagttcttgtca
ctactgcgaatgatgctgggaagcttccagttcaccgctacgtctaccgggcagctctac
gagatgttctactcagtgatgaaatatctgccagggccacagcaacaggcctttaaggag
ctgcagggactggaggacttcatagccaagaaggtggaacaaaaccagcgcacgctggac
cccaactccccacgggacttcatcgactccttcctcatccgcatgcaggaggagaaggag
aatcccaacacggagttctacaggaagaacctggtgatgacaacactgaacctcttcttt
gcgggcaccgagacggtcagcacgaccatgcggtatggcttcctgctgctcatgaagcac
ccagatgtggaggccaaaatccatgaggagattgaccgcgtgatcggcaagaaccgtcag
cccaagtttgaggaccgagccaagatgccctacacagaggctgtgatccacgagatccag
agattcggagacatgatccccatgggcttggctcgcagagtcaccaaggataccaagttt
cgagacttcctgctccccaagggcaccgaagtgttccctatgctgggctctgtgctgaga
gaccccaagttcttctccaacccccgagatttcaatccccagcacttcctggacgagaag
gggcaatttaagaagagtgatgcttttgtgcccttctccatcggtaagagacactgccaa
ctcaacacccacaggggcctcctttatctctaa

DBGET integrated database retrieval system