KEGG   Bos taurus (cow): 540769Help
Entry
540769            CDS       T01008                                 

Gene name
WHSC1
Definition
Wolf-Hirschhorn syndrome candidate 1
Orthology
K11424  
histone-lysine N-methyltransferase NSD2 [EC:2.1.1.43]
Organism
bta  Bos taurus (cow)
Pathway
Lysine degradation
Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:bta00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    540769 (WHSC1)
 Human Diseases
  Cancers
   05202 Transcriptional misregulation in cancers
    540769 (WHSC1)
Enzymes [BR:bta01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     540769 (WHSC1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
Ensembl: 
Position
6
AA seq 1365 aa AA seqDB search
MEFSVRKSPLSAPKVVKCVKMKQAPEVLGSANGKTPSCDVSRECSVFLSKAQLSAGLQDG
VVQKFNGHDALPFIPAERLKDLTSRVFNGEPGAHDAKLRFESQEVKGLGTPPHTTPVKNG
SPEIKLKITKTYMNGKPLFESSICGDGAAAVSHSEADGQRPEYKARRSRKRSAQRGPVLE
HGLGEAALASRLSSPVDKKIPVKRESCPNSSRDKGQLLKYDVGDLVWSKVSGYPWWPCMV
SADPLLHSHTRLKGQKKSARQYHVQFFGDAPERAWIFEKSLVAFEGEGQFEKLCQESAKQ
APTKAEKIKLLKPISGKLRAQWEMGLVQAEAAARMAVEERKAKFTFLYVGDQLRLNPHVA
KEAGVAVESLGEAAEPSGVEEEAADSPKSSGEEGAPVKRRRRAKLSSSTENLPGDPGPGR
ATPQKVAEADSRRGAGSPPGRKKAAASTPRSRRGDAASQFLVFCQKHRDEVVAEHPDASA
EEIEELLASQWNMLNEKQKARYHTKFALVAPPQSEEDSGNLNGKKRSHTKRTQGLRGDAE
VEEAPRKRLRTDRHGLRKRETITDKTARTTSCKALEAASSLKSQAATKHLSDACKPLKKR
HRAPAAAATTLTFSKSSSPSASLTENEVSDGPGDEPPESPDESADETQTEASVSSKRSER
GATARKEHVCQLCEEPGSLVLCEGPCCGAFHLACLGLSRRPEGRLLCGECTSGIHSCFVC
KESKSDVKRCVVSQCGKFYHEACVRRFPLTVFESRGFRCPLHSCLSCHASNPSNPRPSKG
KMLRCVRCPVAYHGGDACLAAGCSVIASNSIICTNHFTARKGKRHHAHVNVSWCFVCSKG
GSLLCCESCPAAFHPDCLSIEMPDGSWFCNDCRAGKKLHFQDIIWVKLGNYRWWPAEVCH
PKNVPPNIQKMKHEVGEFPVFFFGSKDYYWTHQARVFPYMEGDRGSRYQGVRGIGRVFKN
ALQEAEARFREIKLQREARETQESERRPPPYKHIKVNKPYGKVQVHTADISEIPKCNCKP
TDENPCGSDSQCLNRMLMFECHPQVCPAGESCQNQCFTKRQYPETKIVRTDGKGWGLVAK
RDIRKGEFVNEYVGELIDEEECMARIKRAHENDITHFYMLTIDKDRIIDAGPKGNYSRFM
NHSCQPNCETLKWTVNGDTRVGLFAVCDIPAGTELTFNYNLDCLGNEKTVCRCGASNCSG
FLGDRPKTSAPLSSEEKGKKTKKKARRRRTKGEGKKPSEDECFRCGDGGQLVLCDRKSCT
KAYHLPCLGLGKRPFGKWECPWHHCDVCGKPSTAFCHFCPNSFCKDHQDTAAFSSTQDGR
LYCSEHDFRAEPARSAQTEQPCPGPSKAKGRRRRRRCWRRVMEGE
NT seq 4098 nt NT seq  +upstreamnt  +downstreamnt
atggaattcagcgtcaggaaaagccctctttctgctccaaaggtggtgaagtgcgtgaag
atgaagcaggccccggaagtcctgggcagtgccaacgggaagacccctagctgcgacgtg
agccgcgagtgctccgtgttcctgagcaaagcccagctctcggccggcctacaggacggg
gtcgtgcagaagttcaacggccacgatgcgctgccgttcatcccggccgagaggctgaaa
gaccttacctcccgcgtcttcaatggagagcctggtgctcacgatgctaaactgcgtttt
gaatcccaggaagtgaagggacttgggaccccacctcacactacccccgtcaaaaatggc
tctccagaaattaagctgaaaatcaccaaaacctacatgaatgggaaacctctctttgag
tcctccatatgtggcgatggtgcggccgccgtgtcccattcggaagcagacggacagaga
ccagagtacaaggcccggaggagccgcaagaggagcgcacagcgtggccctgtgctggag
cacggcctcggggaggccgccctggcgtccaggctctccagtcccgtggacaaaaagatt
ccagttaagagagaatcctgtccgaatagcagcagagacaaaggccagctgctgaagtac
gatgtcggggacctggtgtggtccaaggtgtctggctacccgtggtggccctgcatggtc
tctgccgacccgctcctgcacagccacaccagactgaaaggtcagaaaaagagtgcacgc
cagtatcacgtacagttctttggtgatgccccagaaagagcttggatatttgagaagagc
cttgtagcttttgaaggagaaggacagtttgaaaaattatgccaggaaagtgccaagcag
gcacccacgaaagctgagaaaattaagctgttgaaacccatttcagggaagttgagggcc
cagtgggaaatgggcctcgttcaggcagaggccgccgcacgcatggcggtggaggagcgg
aaagccaagttcaccttcctctacgtgggggaccagctccgcctcaacccccacgtggcc
aaggaggcgggcgtggctgtagagtcgctgggagaagcagcagagccctcaggagtcgag
gaagaagctgcagacagccctaagtcctcgggggaggagggcgcgcctgtcaagaggaga
aggagggccaagctgtccagctccaccgagaacctccccggcgacccggggccggggcgg
gctacaccgcagaaggtggccgaggccgactccaggaggggcgcgggatctccccccggc
aggaagaaggctgcggcctccaccccgaggagccggaggggcgatgcggcgtcccagttc
ctggtcttctgtcagaagcacagggacgaggtggttgctgagcacccggacgcctctgcc
gaggagattgaggagctgctcgcgtcgcagtggaacatgctcaacgagaagcagaaggcg
cgctatcacaccaagtttgcgctcgtggctccgcctcagtccgaggaagactctggtaac
ttaaatgggaagaaaaggagccacacgaagaggacgcagggcctgcgcggagacgctgaa
gttgaggaggcccccaggaagaggctcaggactgacaggcacggcctgcggaagagagag
acgatcactgacaaaacagcccgcacgacctcttgcaaggcccttgaggcagcgtcctca
ctgaagagccaggcagccacgaaacacctgtctgatgcctgcaagcccctgaagaagcgc
caccgggcccccgcagcggccgccaccaccctcacctttagcaaaagctcatctccttcc
gcgtccttaactgagaacgaggtctcggacggccccggagacgagcccccggagtccccg
gacgagagcgctgacgaaacccagaccgaggcgtccgtctcctctaagaggtcagaacgg
ggagccaccgccaggaaggagcacgtgtgccagctgtgcgaggagccgggcagcctggtg
ctgtgcgagggcccctgctgcggcgccttccacctggcctgcctaggcctctcccgcagg
ccggaggggcggctcctgtgcggagagtgcacctcagggatccactcctgcttcgtgtgt
aaggagagcaagagtgacgtcaagcgctgcgtggtgtcgcagtgtgggaagttctaccac
gaggcctgcgtgcgcaggttccccctgacggtgttcgagagccggggcttccgatgcccg
cttcacagctgcctgagttgccacgcctccaacccctcgaacccaaggccatcgaaaggt
aagatgctgcggtgtgtccggtgccccgtcgcctaccatggaggggatgcgtgtctggcc
gcgggctgctcggtgatcgcatccaacagcatcatctgcacgaaccacttcaccgcccgg
aagggcaagaggcaccacgcacacgtcaacgtgagctggtgcttcgtgtgctccaaaggg
gggagcctgctgtgctgcgagtcctgcccggcggccttccaccccgactgcctgagcatc
gagatgccggacggcagctggttctgcaacgactgcagggctgggaagaagctgcacttc
caggacatcatctgggtgaagctcgggaactacagatggtggccggcagaagtttgccat
cccaaaaatgtccccccaaatattcagaaaatgaagcacgaggttggagaattccctgtg
tttttctttgggtctaaagattattactggactcatcaggcgcgagtgttcccgtacatg
gagggggaccggggcagccgctaccagggggtcagagggatcggaagagtcttcaaaaac
gcactgcaagaggctgaagcgcgtttccgtgaaatcaaacttcagagggaagcccgagag
acgcaggagagcgagcgcaggcccccgccctacaagcacatcaaggtgaacaagccctac
gggaaggtgcaggtccacacggcggacatctctgagatccccaagtgcaactgcaagccc
accgacgagaacccgtgcggctcggactcgcagtgtctgaaccgcatgctcatgttcgag
tgccacccgcaggtctgccccgcgggggagtcctgccagaaccaatgcttcaccaagcgc
cagtaccccgagaccaagatcgtcaggacggacggcaagggctggggcctggtggccaag
cgggacatcaggaagggggagtttgtgaacgagtatgtgggcgagctgattgacgaggag
gagtgcatggcgaggatcaagcgtgcgcacgagaacgacatcacccacttctacatgctc
accatagacaaggaccgcatcatcgacgccggccccaaggggaactactcccggttcatg
aaccacagctgccagcccaactgcgagaccctcaagtggacagtgaatggggacacgcgc
gtgggcctgttcgccgtgtgtgacatccccgcagggacagagctgaccttcaactacaac
ctcgactgtctgggcaacgagaagacggtgtgtcgctgcggagcctccaactgcagcggc
ttcctcggtgacaggccgaagacgtcagcacccctgtcctcggaggagaagggcaagaag
accaagaagaaggcccggaggcgccgcacgaagggcgaggggaagaagccgtccgaggac
gaatgcttccgctgcggcgacggcggccagctggtgctgtgcgaccgcaagtcctgcacc
aaggcctaccacctgccctgcctgggcttgggcaagcggcccttcgggaagtgggagtgc
ccttggcaccactgcgacgtgtgtggcaaaccctccactgccttctgccacttctgcccc
aactccttctgcaaggaccaccaggacacagcggccttcagctccacccaggatgggcgg
ttgtactgcagcgagcacgacttccgggcggagccggcccggagcgcccagaccgagcag
ccctgcccggggcccagcaaggccaaggggcggcggcggcggcggcggtgttggcgcagg
gtcatggaaggcgaatag

DBGET integrated database retrieval system