KEGG   Bos taurus (cow): 540771Help
Entry
540771            CDS       T01008                                 

Gene name
PLCD4
Definition
phospholipase C, delta 4 (EC:3.1.4.11)
Orthology
K05857  
phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
bta  Bos taurus (cow)
Pathway
Inositol phosphate metabolism
Metabolic pathways
Calcium signaling pathway
Phosphatidylinositol signaling system
Thyroid hormone signaling pathway
Module
Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:bta00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    540771 (PLCD4)
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    540771 (PLCD4)
   04070 Phosphatidylinositol signaling system
    540771 (PLCD4)
 Organismal Systems
  Endocrine system
   04919 Thyroid hormone signaling pathway
    540771 (PLCD4)
Enzymes [BR:bta01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     540771 (PLCD4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
Ensembl: 
UniProt: 
Position
2
AA seq 791 aa AA seqDB search
MAYLLQGRLPINQDLLLMQKGTMMRKVRSKSWKKLRFFRLQDDGMTVWHARQAGGRAKPS
FSISDVDTVREDHESELLRNLAEEFPLEQGFTIVFHGRRSNLDLVANSVQEAQTWMQGLQ
LLVGFVTNMDQQERLDQWLSDWFQRGDKNQDGRMSFGEVQRLLHLMNVEMDQEYAFQLFQ
TADTSQSGTLEGEEFVEFYKSLTQRPEVQELFEKFSSDGQKLTLLEFVDFLQEEQKEGER
ASDLALELIDRYEPSESGKLRHVLSMDGFLGYLCSKDGDIFNPTCHPLYQDMTQPLNHYY
INSSHNTYLVGDQLCGQSSVEGYIRALKRGCRCVEVDIWDGPSGEPIVYHGHTLTSRIPF
KDVVAAIGQYAFQTSDYPVILSLENHCSWEQQEIIVRHLTEILGDQLLTTALDGQPPTQL
PSPEDLRGKILVKGKKLMLEEEEEEPEAELEAEQEARLDLEAQLESEPQDLSPRSEDKKK
VVMCPLLCRPLCCQIMAQAPISKPGLLLFPKQKPKAILCPALSALVVYLKAVTFYSFTHS
REHYHFYETSSFSETKAKSLIKEAGDEFVQHNAWQLSRVYPSGLRTDSSNYNPQEFWNAG
CQMVAMNMQTAGLEMDLCDGLFRQNAGCGYVLKPDFLRDAQSSFHPERPISPFKAQTLII
QVISGQQLPKVDNTKEQSIVDPLVRVEIFGVRPDTTRQETSYVENNGFNPYWGQTLCFRI
LVPELALLRFVVKDYDWKSRNDFIGQYTLPWSCMQQGYRHIHLLSKDGLSLHPASIFVHI
CTQEVSEEAES
NT seq 2376 nt NT seq  +upstreamnt  +downstreamnt
atggcgtatctgctgcaaggccggctgcccatcaatcaagatctgctgctgatgcagaaa
ggcacaatgatgcgcaaggtgaggtccaaaagctggaagaagctaagattcttcagactt
caggacgatggcatgacagtctggcatgcccggcaggctggaggcagggccaagcccagc
ttctcaatctccgacgtggacacagtacgtgaggaccacgagtctgagttgctgcgcaac
ctggcagaggagttccccctggagcagggcttcaccatcgtcttccatggccgccgctcc
aacctggacctggtggccaacagtgtccaggaagcccagacctggatgcaggggctccag
ctgttggtgggctttgtcaccaacatggaccaacaggagaggctggatcaatggctgagt
gattggttccagcgcggagacaaaaaccaggatggtcggatgagtttcggagaggtccaa
cggttattgcacctgatgaatgtggaaatggaccaggaatatgcctttcagcttttccag
acagcagacacatcccagtctgggactctggagggagaagaatttgtagagttctataag
tcattgactcagcgtccagaagtgcaggaactgtttgaaaagttttcatctgatgggcag
aaactgaccctgttggaatttgtggatttcctccaagaggaacagaaggaaggagaacgg
gcttctgaccttgctctggaactcatcgaccgctatgagccttcagaaagtggaaaactg
cggcatgtgctgagcatggatggcttcctcggctacctctgctcgaaggacggagacatc
ttcaatccaacctgccaccccctctaccaggacatgactcaacccctgaaccactactac
atcaactcctcccacaacacctacctggtgggggaccagctttgtggccagagcagcgtg
gagggatacatacgggccctgaagcgggggtgccgctgtgtggaggtggatatatgggat
ggaccaagcggggaacctattgtttaccacggacacaccctgacctcccgcatcccattc
aaagatgttgtggccgctataggacagtatgccttccagacgtcagactatccagtcatc
ttgtcgctggagaaccactgcagctgggagcagcaggagatcatcgtgcgccatctgacg
gagatcctgggggatcagctactgacgacagccttggatgggcagcctcccactcagctg
ccctcccccgaggaccttcgggggaagatccttgtgaaggggaagaagctaatgcttgag
gaagaggaggaagaaccagaggctgaattggaagcagagcaggaggctaggctggacttg
gaggcccagctggagtctgagccccaggacctgagccctcgcagtgaggacaaaaagaag
gttgtgatgtgcccgctgttgtgtcggcctttgtgttgtcagattatggcccaggctcct
atttccaagcctgggcttcttctctttcccaagcagaaacccaaggccatcttgtgtcca
gccctctctgccctggttgtctacttgaaggctgtcacattctatagcttcactcactcg
agggagcactaccacttctatgaaacatcatctttctctgaaaccaaggccaagagcctc
atcaaggaggctggtgacgagtttgtgcagcacaatgcctggcagttaagcagagtgtat
cccagtggcctgaggacggattcatccaactacaacccccaggaattctggaatgcaggc
tgccagatggtggctatgaacatgcagacagccgggctggagatggacctgtgtgatggg
ctcttccgccagaacgctggctgtggctatgtgctgaagccagacttcctgcgcgatgcc
cagagttccttccaccctgagaggcccatcagccctttcaaagcccagaccctcatcatc
caggtaatcagtggtcagcaactccccaaagtggacaacaccaaagaacagtccattgtg
gaccccttggtgagagtggagatctttggcgtccgcccagacacaacccggcaagagacc
agctacgtggagaacaatggttttaatccatactgggggcagacactgtgcttccggatc
ctggtacctgaactggccctgctgcgttttgtggtcaaagactatgactggaaatcccga
aacgacttcattggtcagtacaccctgccgtggagctgcatgcagcaaggttaccgccac
atacacctgctctccaaggatggcctcagccttcacccagcttccatctttgtgcacatc
tgcacacaggaagtgtcagaggaggctgaatcttaa

DBGET integrated database retrieval system