KEGG   Bos taurus (cow): 541281Help
Entry
541281            CDS       T01008                                 

Gene name
THBS4, TSP-4
Definition
thrombospondin 4
Orthology
K04659  
thrombospondin 2/3/4/5
Organism
bta  Bos taurus (cow)
Pathway
Phagosome
PI3K-Akt signaling pathway
Focal adhesion
ECM-receptor interaction
Malaria
Brite
KEGG Orthology (KO) [BR:bta00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    541281 (THBS4)
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    541281 (THBS4)
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    541281 (THBS4)
  Cell communication
   04510 Focal adhesion
    541281 (THBS4)
 Human Diseases
  Infectious diseases
   05144 Malaria
    541281 (THBS4)
Exosome [BR:bta04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   541281 (THBS4)
  Exosomal proteins of colorectal cancer cells
   541281 (THBS4)
  Exosomal proteins of bladder cancer cells
   541281 (THBS4)
Heparan sulfate/heparin binding proteins [BR:bta00536]
 Extracellular matrix molecules (General comment) Storage depot, cell adhesion and motility, ECM/barrier formation
  541281 (THBS4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
Ensembl: 
UniProt: 
Position
10
AA seq 961 aa AA seqDB search
MLAPRGATFLLLHLALQPWLGAGAQATPQVFDLLPSASQRLNPSVLQPILTDPTLNELYV
ISTFKLQSKSSATIFGLYSSADHSKYFEFTVMGRLNKAILRYLKNDGRIHLVVFNNLQLA
DGRRHRLLLRLTNLHRGAGSVELFLDCTRVDSIHNLPRAFSGLAQSPEAVELRTFQRKAH
DSLEELKLVVRGSLIQVASLQDCFLQQSEPLATTNTGDFNRQFLGQMSQLNQLLGEVKDL
LRQQVKETSFLRNTIAECQACGPLSFQSPTPNTLMPVVPAASPTPPVRRCDSNPCFRGVR
CTDTRDGFQCGPCPEGYTGNGIVCSDVDECRYHPCYPGVRCVNLAPGFRCDACPVGFTGP
MMQGVGISFAKTNKQVCTDIDECRNGACVLNSICINTLGSYRCGPCKPGYIGDQMRGCKM
ERNCRDPELNPCSVNAQCIEERQGDVTCVCGVGWAGDGYICGKDVDIDSYPDEELPCSAR
NCKKDNCKYVPNSGQEDADRDGIGDACDDDADGDGILNEQDNCVLTHNVDQRNSDKDIFG
DACDNCRNVLNNDQKDTDGDGKGDACDDDMDGDGIKNILDNCQKVPNSDQEDRDGDGVGD
ACDSCPEVSNPNQSDVDNDLVGDSCDTNQDSDGDGHQDSTDNCPTVINSAQLDTDKDGIG
DECDDDDDNDGIPDLVPPGPDNCRLVPNPAQEDSNSDGVGDICEADFDQDQVIDRIDVCP
ENAEVTLTDFRAYQTVVLDPEGDAQIDPNWVVLNQGMEIVQTMNSDPGLAVGYTAFNGVD
FEGTFHVNTQTDDDYAGFIFGYQDSSSFYVVMWKQTEQTYWQATPFRAVAEPGIQLKAVK
SKTGPGEHLRNSLWHTGDTSDQVRLLWKDSRNVGWKDKVSYRWFLQHRPQVGYIRVRFYE
GSELVADSGVTIDTTMRGGRLGVFCFSQENIIWSNLKYRCNDTIPEDFQEFQTQNFDRLD
K
NT seq 2886 nt NT seq  +upstreamnt  +downstreamnt
atgttggccccgcgcggagccaccttcctcctgctgcacctggccctgcagccctggctg
ggggccggcgcccaggccaccccgcaggtctttgaccttctcccatctgccagccagagg
ctgaacccgagtgttctgcagccgatcctgacagaccccactctgaacgagctctacgtg
atctccaccttcaagctgcagtcgaaaagctcagccaccatcttcggcctttactcttca
gctgatcacagcaaatattttgaatttactgtcatgggacgtttaaataaagccatcctc
cgttacctgaagaacgacgggaggattcacctggtggttttcaacaacctgcagctggct
gacggcaggaggcacaggctgctgctgagactgaccaacctccaccggggggccggctcc
gtagagctgttcctggactgcacacgcgtggactccatccacaacctccccagagccttt
tccggcctcgcccagagtcctgaggctgtggaactgaggactttccagaggaaggcacac
gactctttggaagagctgaagctggtggtgagaggctcgctgatccaggtggccagcctg
caagactgcttcctgcagcagagcgagccactggccaccacaaacacaggagactttaat
cggcagttcttggggcagatgtcacaactaaaccaactactgggagaggtgaaggatctt
ctgagacagcaggtcaaggaaacatcatttttgcgaaacaccatagccgaatgccaggct
tgcggtcctctcagctttcagtctccaacccccaacactctgatgcctgtggtacccgcg
gcatccccgacaccccccgtgcgccgctgtgattccaacccgtgtttccgcggcgtgcga
tgcaccgacaccagagatggctttcagtgcggaccctgccccgagggctacacaggaaat
gggatcgtctgttccgatgtcgatgagtgtaggtaccacccctgctatcctggcgtgcgc
tgtgtaaacctggctcctggcttcagatgtgatgcctgcccggtgggcttcacggggccc
atgatgcagggcgttgggatcagtttcgccaagacaaacaagcaggtctgcactgatatt
gatgagtgtcgaaacggagcatgtgttcttaattctatctgtattaacactttgggatct
tatcgctgtgggccttgcaaaccagggtacatcggtgatcagatgaggggatgcaaaatg
gaaagaaactgcagagatccagaactgaacccttgcagtgtgaacgcccagtgcatcgaa
gagaggcagggggatgtgacgtgcgtgtgtggggtcggctgggctggtgacggctacatc
tgtggaaaggatgtggacattgacagttaccctgatgaggagctgccatgctcggccaga
aactgcaaaaaggacaactgcaagtatgtgccaaattctggccaagaagatgcagacagg
gatggcattggagacgcctgtgatgatgatgctgatggagacgggatcctgaatgagcag
gataactgtgtcctgacccacaacgtggaccagaggaacagtgacaaagacatctttggg
gatgcctgtgataactgccggaacgtgctgaataatgaccagaaagacactgatggggat
gggaaaggagatgcctgtgatgacgacatggatggggacggaataaaaaacatcctggac
aactgccagaaagttcccaatagtgaccaagaagacagagacggtgacggtgtgggggat
gcctgtgacagctgtcctgaggtcagcaacccaaaccagtctgacgtggataatgatctg
gttggggactcctgtgacaccaatcaggacagcgacggagacgggcaccaggacagcaca
gacaactgccccaccgtcatcaacagtgcccagctggacacagacaaggatggcattggt
gacgagtgtgacgatgatgacgacaacgacggcatcccagacttggtaccccctggcccg
gacaactgccggctcgtccccaaccccgcccaggaggacagcaacagcgacggagtggga
gacatctgtgaggcagactttgaccaggaccaggtcattgatcggatagacgtgtgccca
gagaacgcagaggtcaccctgaccgacttcagggcctatcagaccgtggtcctggaccct
gaaggggatgcccagatcgaccccaactgggtggtcctgaaccagggcatggagattgtg
cagaccatgaacagcgatcctggcctggcagtggggtacacggcttttaatggagttgac
ttcgaagggaccttccacgtcaacacccagacggacgatgactacgctggcttcatcttt
ggttaccaggacagctccagcttctacgtggtcatgtggaagcagacagagcagacatac
tggcaggccaccccattccgagctgtcgcggaacctggcattcagctcaaggccgtgaag
tccaagacgggtccaggggagcatctccgcaactcgctgtggcacacgggggacaccagt
gaccaggtcaggctgctgtggaaggactccaggaacgtgggctggaaggacaaggtgtcc
taccgctggttcctgcagcaccggccccaggtgggctacatcagggtgcgattttatgaa
ggctctgagttggtggctgattctggggtcaccatagacaccaccatgcgtggaggccgg
ctcggcgtgttctgcttctcccaggaaaacatcatttggtccaacctgaaatatcgctgc
aatgacaccatcccagaggacttccaagaatttcagacccagaattttgatcgcctggat
aaataa

DBGET integrated database retrieval system