KEGG   Bos taurus (cow): 613425Help
Entry
613425            CDS       T01008                                 

Gene name
UROS, UROIIIS
Definition
uroporphyrinogen III synthase (EC:4.2.1.75)
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
bta  Bos taurus (cow)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bta00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    613425 (UROS)
Enzymes [BR:bta01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     613425 (UROS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
Ensembl: 
UniProt: 
Position
26
AA seq 264 aa AA seqDB search
MKVLLLKDPKEDDCGQDPYVRELGLYGLEATLIPVLSFEFLSLPSLSEKLSHPEGYGGLI
FTSPRAVEAVERCLQKDTKAEVWKKSLKEKWNAKSVYVVGNATASLVNRIGLHTEGETCG
NAEKLAEYICSREPSALPLLFPCGTLKREILPKMLKDKGIPLESVTVYQTIPHPGIQGNL
TSYYTQQGVPASITFFSPSGLTHSLKHIQELSGDSIGQIKFVAIGPTTAQALAAQGLPVS
CTAESPTPRALAAGIRTTLQPHAC
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgaaggttcttttgctgaaagaccccaaggaggacgactgtggccaggacccctacgtc
agggagctgggattatatgggctcgaagccactttgatccctgttttatcgtttgagttt
ctgtctctccccagtctgtcggagaagctgtctcatcccgaaggttacgggggactcatt
ttcaccagtcccagagcagtggaagccgtggagcggtgtttgcagaaagacactaaagct
gaagtctggaaaaagtctctgaaagaaaaatggaatgctaagtcggtgtatgtggtggga
aatgctactgcttctctagtgaatagaattggcctgcatacagaaggagaaacctgtgga
aacgcagaaaagcttgcagaatacatttgctccagggagccttcggcactgcctcttctg
tttccctgcggaaccctcaagagagagatcctgccaaaaatgctcaaggacaaagggatc
cccttggagagtgtaaccgtctaccagactattccacacccagggatccaggggaacctc
accagctactacacccagcagggtgttcccgccagtatcacattttttagtccctctggc
ctgacacacagtctcaagcacattcaagagttatctggtgacagcattggccaaattaag
ttcgtggccatcggccccaccacggcccaagccctggccgcacagggcctgcccgtgagc
tgcaccgcggagagccccacgccacgcgccctggccgctggcatcaggacgacgctccag
ccccacgcatgctga

DBGET integrated database retrieval system