KEGG   Bos taurus (cow): 613533Help
Entry
613533            CDS       T01008                                 

Gene name
FLNB
Definition
filamin B, beta
Orthology
K04437  
filamin
Organism
bta  Bos taurus (cow)
Pathway
MAPK signaling pathway
Focal adhesion
Salmonella infection
Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:bta00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    613533 (FLNB)
 Cellular Processes
  Cell communication
   04510 Focal adhesion
    613533 (FLNB)
 Human Diseases
  Cancers
   05205 Proteoglycans in cancer
    613533 (FLNB)
  Infectious diseases
   05132 Salmonella infection
    613533 (FLNB)
Exosome [BR:bta04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   613533 (FLNB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
Ensembl: 
UniProt: 
Position
22
AA seq 2633 aa AA seqDB search
MPVTEKDLAEDAPWKKIQQNTFTRWCNEHLKCVNKRIGNLQTDLSDGLRLIALLEVLSQK
HMYRKYHQRPTFRQMQLENVSVALEFLDRESIKLVSIDSKAIVDGNLKLILGLVWTLILH
YSISMPVWEDEGDDDAKKQTPKQRLLGWIQNKIPYLPITNFNQNWQDGKALGALVDSCAP
GLCPDWESWDPRKPVDNAREAMQQADDWLGVPQVITPEEIIHPDVDEHSVMTYLSQFPKA
KLKPGAPLKPKLNPKKARAYGRGIEPTGNMVKQPAKFTVDTISAGQGDVMVFVEDPEGNK
EEALVTPDSDKNKTYSVEYLPKVTGLHKVTVLFAGQHISKSPFEVNVDKAQGDASKVTAK
GPGLEVASNIANKPTYFDIYTAGAGVGDIGVEVEDPQGKNTVELLVEDRGNQVYRCVYKP
MQPGPHVVKVSFAGDTIPKSPFVVQVGEACNPNACRASGRGLQPKGIRIRETADFKVDTK
AAGSGELGVTIKGPKGLEELVKQKGFQDGVYAFEYYPSTQGKYSVSITWGGHHIQKSPFE
VQVGPEAGMQKVRAWGPGLHGGIVGRSADFVVESIGSEVGSLGFAIEGPSQAKIEYDDQN
DGSCDVKYWPKEPGEYAVHIMCDDEDIKDSPFMAYIHPASGDYNPDLVQAYGPGLEKSGC
IVNNLAEFTVDPKDAGKAPLKIFAQDGDGQPIDIQMKSRMDGTYACSYTPVKAIKHTIAV
VWGGVNIPHSPYRVSIGQGSHPQKVKVFGPGVERSGLKAHEPTHFTVDCTEAGEGDVSVG
IKCDARVLSDEEEDVDFDIIHNANDTFTVKYVPPAAGRYTIKVLFASQEIPTSPFRVKVD
PSHDASKVKAEGPGLSKAGVENGKPTHFTVYTKGAGKAPLNVQFSSPGPGDAVKDLDIID
NYDYSHTVKYTPTQQGNMQVLVTYGGDPIPKSPFTVGVAAPLDLSRIKINGLENRVEVGK
DQEFAVDTRGAGGQGKLDVTILSPSRKVVPCLVAPMAGREGSTAKFIPREEGLYAIDLTY
DGHPVPGSPYVVEASLPPDPTKVKAHGPGLRGGLVGKPAEFTIDTKGAGTGGLGLTVEGP
CEAKIECSDNGDGTCSVSYLPTKPGEYFVNILFEEVHIPGSPFKADIEMPFDPSKVVASG
PGLEHGKVGEPGLLSVDCSEAGPGTLGLEAVSDSGAKAEVCIENNKDGTYAVTYVPLTAG
MYTLTMKYGGELVPHFPTRVKVEPAVDTSRVKVFGPGIEGKDVFREATTDFTVDSRPLTQ
VGGDHIKAHIANPSGASTECFVTDNADGTYQVEYTPFEKGLHVVEVTYDDVPVPNSPFKV
AVTEGCQPSRVQAQGPGLKEAFTNKPNVFTVVTRGAGIGGLGITVEGPSESKINCRDNKD
GSCSAEYVPFAPGDYDVNITYGGAHIPGSPFRVPVKDVVDPSKVKIVGPGLGSGVRARVL
QSFTVDSSKAGLAPLEVRVMGPRADQTISWSRRSPLKAISGFFKRDRKGDFMETGLVEPV
NVVDNGDGTHTVTYTPSQEGPYMVSVKYADEEIPRSPFKVKVLPTYDASKVTASGPGLST
YGVPASLPVEFAIDARDAGEGLLAVQITDQEGKPKRAIVHDNKDGTYAVTYIPDKTGRYM
IGVTYGGDDIPLSPYRIRATQTGDASKCLATGPGIASTVKTGEEVGFVVDAKTAGKGKVT
CTVLTPDGTEAEADVIENEDGTYDIFYTAAKPGTYVIYVRFGGVDIPNSPFTVMATDGEV
AAVKEVPVNACPPGFRPWVTEEAYVPVSNMNGLGFKPFDLVIPFAVRKGEITGEVHMPSG
KTAKPEIVDNKDGTVTVRYAPTEVGLHEMHIKYMGSHIPESPLQFYVNYPNSGSVSAYGP
GLVYGVANKTATFTIVTEDAGEGGLDLAIEGPSKAEISCIDNKDGTCTVTYLPTLPGDYS
ILVKYNDKHIPGSPFTAKITDDSRRCSQVKLGSAADFLLDISETDLSTLTASIKAPSGRD
EPCLLKRLPNNHIGISFIPREVGEHLVSIKKNGNHVANSPVSIMVVQSEIGDARRAKVYG
RGLSEGRTFEMSDFIVDTRDAGYGGISLAVEGPSKVDIQTEDLEDGTCKVSYFPTVPGVY
IVSTKFADEHVPGSPFTVKISGEGRVKESITRTSRAPSVATVGSICDLNLKIPEIDSSDM
SAHVTSPSGRVTEAEIVPVGKNSHCVRFVPQEMGVHTVSVKYRGQHVTGSPFQFTVGPLG
EGGAHKVRAGGPGLERGEAGVPAEFSIWTREAGAGGLSIAVEGPSKAEITFDDHKNGSCG
VSYIAQEPGNYEVSIKFNDEHIPESPYVVPVIAPSDDARRLTVLSLQESGLKVNQPASFA
IRLNGAKGKIDAKVHSPSGAVEECHVSELEPDKYAVRFIPHENGIHTIDVKFNGSHVVGS
PFKVRVGEPGQAGNPALVSAYGAGLEGGSTGIQSEFFINTTRAGPGTLSVTIEGPSKVKM
DCQETPEGYKVMYTPMAPGNYLIGVKYGGPNHIVGSPFKAKVTGQRLVSPGSANETSSIL
VESVTRSSTETCYSAIPKASSDASKVTSKGAGLSKAFLGQKSSFLVDCSKAGSNMLLIGV
HGPTTPCEEVSMKHVGNQQYNVTYVVKERGDYVLAVKWGEEHIPGSPFHVTVP
NT seq 7902 nt NT seq  +upstreamnt  +downstreamnt
atgcccgtaaccgagaaggacctggcggaggacgcgccctggaagaagatccagcagaac
accttcacgcgttggtgcaacgagcaccttaagtgcgtgaacaagcgcatagggaacctg
cagaccgacctgagcgacgggctgcggctcatcgcgctcctggaggtgctcagccagaag
cacatgtaccgcaagtaccaccagcggcccaccttccgccagatgcagctggagaacgtg
tccgtggcgctcgagttcctggaccgcgagagcatcaagctcgtgtccatcgacagcaaa
gccatcgtggatgggaacctgaagctcatcttgggcctggtgtggacgctcatcctccac
tactccatctccatgcccgtgtgggaggatgaaggagacgatgatgccaagaagcagacg
ccaaagcagaggctgcttgggtggattcagaacaagatcccctacttgcccatcaccaac
ttcaaccaaaactggcaagacggcaaagccctgggagccttggtagacagttgtgctcca
ggtctttgcccagactgggaatcctgggatccacgaaagcctgtggataatgcacgagaa
gccatgcagcaggcagacgactggctaggcgtcccacaggtcatcactcctgaagaaatt
attcacccggatgtggatgaacactcagtgatgacttacctgtcccagttccccaaagcc
aagctcaagcctggagctccccttaaacccaaactcaaccccaagaaagccagggcctat
ggtagaggtatcgagcccactgggaacatggtgaagcagccggccaagttcaccgtggac
acaatcagcgccgggcaaggtgatgtcatggtgtttgttgaggacccagaagggaacaaa
gaggaggcactcgtgacccctgacagcgataagaacaagacatactctgtggagtatctg
cccaaggtcactggactgcacaaagtcacagtcctctttgcaggacagcacatctccaag
agcccattcgaggtgaatgtcgacaaggcccagggagatgccagtaaagtcactgcgaaa
ggcccaggcttggaagttgccagcaacatcgccaataagcccacctattttgacatctac
acagcaggtgctggcgtgggcgacattggtgtggaggtggaggatccccaggggaagaac
accgtggagttgctcgtggaagacagaggaaaccaagtgtatcgatgtgtgtacaaacca
atgcagcctggcccccacgtggtcaaggtttcctttgctggggacaccatccccaagagt
cccttcgttgttcaggttggggaagcctgcaatccaaacgcctgccgggccagtggccga
ggcctgcagcctaaaggcattcgcatccgagaaactgcagacttcaaggttgacaccaaa
gctgctggaagtggagagctcggcgtcaccattaagggtcctaagggtctggaggagctg
gtgaaacagaaaggctttcaggatggagtctatgcatttgagtattaccccagcacccag
gggaaatacagcgtctccatcacgtggggaggacaccacattcaaaagagcccttttgaa
gttcaagttggccctgaagcaggcatgcagaaagtccgtgcatggggacctggcctccac
ggcgggattgttgggcggtcagcggacttcgttgtggagtccattggttctgaagtgggg
tctctggggtttgccattgaaggcccctcccaggcgaagattgaatatgacgaccagaat
gacgggtcatgtgatgtcaagtactggcccaaggagccgggcgaatatgccgttcacatc
atgtgcgacgatgaggacatcaaggacagtcccttcatggcctacatccacccggcctcg
ggagactacaacccggacctggtgcaagcatacgggccaggtttggagaaatccggatgc
attgtcaacaacctggctgagttcaccgtggatcctaaggatgccggaaaagctccctta
aagatatttgctcaggacggggacggccagcctattgacatccagatgaagagccggatg
gatggcacctacgcctgctcatacaccccagttaaggccatcaagcacaccattgccgtg
gtctggggaggtgtcaacatcccgcacagcccttaccgggtcagcatcggacagggtagc
catccccagaaggtcaaagtgtttgggccaggagtggagagaagtggactgaaggcacac
gagcctactcacttcaccgtggactgtactgaggctggcgaaggtgatgtcagcgttggc
attaaatgtgatgcccgggtgttaagtgacgaggaggaagacgtggattttgacattatt
cacaacgccaatgatacatttactgtcaaatatgtgcctcctgctgccgggcgatacacc
atcaaagttctctttgcctctcaggaaatccccaccagccctttcagagtcaaggtcgac
ccttcccacgatgccagcaaagtgaaggcagaaggcccagggctcagcaaagcaggtgtg
gaaaacgggaaacccacccacttcactgtgtacaccaagggggctggaaaggccccgctc
aacgtgcagttcagcagccctggccctggcgacgccgtgaaggatctggatatcatcgat
aactatgactactctcacaccgttaaatacacacccacccagcagggcaacatgcaggtt
ctggttacatacggtggtgaccctatccctaagagcccattcactgtgggtgtggctgct
ccgctggatctgagcaggataaaaattaatggactggaaaacagagtcgaagttgggaag
gaccaggagttcgccgtggacaccaggggagcaggaggccaggggaagctggacgtgacg
atcctgagcccctcaaggaaggtcgtgccgtgtctggtggcacccatggcaggccgggag
ggcagcacagccaagttcatcccacgggaggaagggctgtatgccatcgacttgacctat
gacggacatcctgtgcccggaagcccttacgtggtggaggcctcgctgccacctgatccc
accaaggtgaaggcccatggtcctggcctcagaggtggtcttgtgggcaagcctgccgag
ttcaccatcgacaccaaaggagctggaactggaggtctcggcctaaccgtggaaggccca
tgcgaggccaaaattgaatgctcagacaacggcgatgggacctgttctgtctcctacctc
ccgacaaagcccggggagtacttcgtcaacattctcttcgaagaagtccacatacctggc
tctcccttcaaagccgacattgaaatgccttttgacccctccaaagtcgtggcgtccggc
ccgggcctcgagcatgggaaggtgggcgagcccgggctgctcagcgtggactgttcagaa
gctgggccagggaccctgggcctggaagctgtctcggactcaggggcaaaagccgaagtc
tgtatcgagaacaacaaagatggtacctatgcggtgacctatgtgcccctgacggccggc
atgtacacgctgaccatgaagtacggcggggagctggtgccacacttccccaccagggtc
aaggtggagcccgccgtggacaccagtagggtcaaagtctttgggccgggaatagaagga
aaagacgtgtttcgtgaagccaccaccgatttcacggtggactcacggcccctgacgcag
gtcggaggcgaccacatcaaggcccacattgccaacccctccggagcctccacggagtgt
ttcgtcacagacaatgctgatgggacctaccaggtggaatacacgcccttcgagaaaggc
cttcacgtagtggaggtaacctacgatgacgtgcctgtcccaaatagtccctttaaagtg
gccgtgaccgaaggctgccagccttctcgggttcaagctcaaggacctggattgaaggag
gctttcaccaacaagcccaacgttttcacggtggttaccagaggggcaggaattgggggt
ctcggcataactgtggagggaccgtccgagtcaaagataaactgcagagacaacaaagat
ggcagctgcagtgcagagtacgttccctttgctccgggagattacgacgtgaatatcaca
tacggaggtgcccacattcctggcagccccttcagggttcctgtgaaggatgttgtggac
cccagcaaggtcaagatcgttggccctgggctgggctccggtgtccgagctcgcgtcttg
cagtccttcacggtggacagcagcaaggctggcctggcccctctggaagtgagggtcatg
ggtccacgagctgatcagacgatttcctggtcaaggcgcagccccttgaaagccatttca
gggttctttaagcgtgaccggaagggtgactttatggagacaggcctggtggagccagtg
aacgtggtggacaatggcgatggcacacacacagtgacctacaccccatcccaggagggc
ccttacatggtctctgttaagtacgcggacgaagagatcccgcgtagtccctttaaggtc
aaggtccttcccacatacgatgccagcaaagtgaccgccagtggtcctggcctcagtacc
tacggtgtgcctgccagcctgcctgtggagtttgccatcgatgccagagatgctggggaa
ggcctgcttgctgttcagataacggaccaagaggggaaacccaaaagagccattgtccac
gataataaagatggcacatatgccgtcacttacatcccggacaagactggacggtatatg
attggggtcacctacggtggggatgacatcccattgtctccctaccgcatccgggccaca
cagacgggtgatgccagcaagtgcctggccacggggcctggaatcgcctctactgtgaaa
accggcgaggaagtgggctttgtggtcgatgccaagaccgccgggaagggcaaagtgact
tgcacagttttgaccccagacggcaccgaggctgaggccgatgtcatcgagaatgaggac
ggcacctatgacatcttctacacagctgccaagccgggcacctacgtcatctatgtgcgc
tttggtggcgtcgacattcccaacagtcccttcactgtcatggccacagatggggaagtc
gcagctgtgaaggaagtaccggtaaatgcatgtccccctggattcaggccctgggtaaca
gaagaggcctatgtcccagtgagcaacatgaacggcctgggatttaagcctttcgacttg
gtcattccatttgcagtcaggaaaggagaaatcaccggagaggtccacatgccttccggg
aagacggccaagcccgagattgtggacaacaaggacggcacagtcactgtcagatacgcc
cccacggaggttggcctccacgagatgcacatcaagtacatgggcagccacattcctgag
agccccctccagttctacgtgaactaccccaacagtgggagcgtgtctgcgtacggccca
ggcctggtgtacggagtggccaacaaaaccgccaccttcaccatcgtcaccgaagacgcc
ggagaaggtggcctggacttggctatcgagggaccctcaaaggccgaaatcagctgtatt
gacaacaaagatgggacgtgcacggtgacttacctgcccaccttgccgggcgactacagc
atcctggtcaagtacaatgacaaacacatccctggcagccccttcacagccaagatcaca
gacgacagcagacggtgctctcaggtgaagctgggctcagccgccgacttcttgcttgac
atcagcgagactgacctcagcaccttgacggccagcatcaaggccccgtccggtcgtgac
gagccttgtctcctgaagaggctgcccaacaatcacatcggcatctccttcattccccgg
gaggtgggtgaacacctggtcagcatcaagaagaacggcaaccacgtggccaacagcccc
gtatccatcatggtggtccagtcggagattggggatgcccgcagagccaaagtctatggc
cgtggcctgtcagaaggccggactttcgagatgtctgacttcattgtggacacgagagat
gcaggttacggaggcatctccttggcggtggaaggccctagcaaggtggacatccagacc
gaggacctggaggacggcacctgcaaggtctcctacttccccactgtgcctggggtttat
atcgtctccaccaagttcgctgacgagcacgtgcctgggagcccgttcaccgtgaaaatc
agcggggagggaagagtcaaggagagcatcacccgtaccagccgagccccgtctgtggcc
actgttggcagcatctgtgacctgaacctgaaaatcccagaaattgacagcagtgacatg
tcagcccacgtcaccagcccctctggccgcgtgaccgaggcggagatcgtgccggtgggg
aagaactcgcactgcgtccggttcgtgccccaggagatgggcgttcacaccgtcagcgtc
aagtaccgtggccagcacgtcactggcagccccttccagttcactgtggggccgctgggc
gaggggggtgcccacaaggtccgggcaggcggccctggcctggagcgaggagaagccgga
gttccggcggagttcagcatctggacccgggaggcaggcgccgggggcctctccatcgcc
gtggagggccccagtaaggccgagattacattcgatgaccataaaaacggatcttgtggt
gtgtcttatattgcccaggaacctggtaactacgaggtctccatcaagttcaatgacgag
catattcccgaaagtccctatgtggtgccggtgatcgcgccctcggacgacgcccgccgc
ctcactgttctgagccttcaggaatcgggattaaaagttaatcagccagcctcctttgct
ataaggttgaacggggcaaaaggcaagatcgatgcaaaggtgcacagcccctctggagcc
gtggaggaatgccacgtgtctgagctggagccagataagtatgctgttcgcttcatcccc
cacgagaatggtatccacacgattgacgtcaagttcaacgggagccacgtggttggaagt
cccttcaaagtgcgcgtcggggagcctggacaagcggggaaccccgccctggtgtcggcc
tatggcgcagggcttgagggaggctccacaggtatccagtcagaatttttcatcaatacc
acccgagcagggccagggacattatccgtcaccatcgaagggccgtccaaggttaaaatg
gattgccaggaaacccccgaagggtacaaggtcatgtacacccccatggctcctggaaac
tacctgattggcgtcaaatatggcgggcccaaccacatcgtgggcagcccgttcaaggcc
aaggtgacaggccagcgtctggtcagccccggctcggccaacgagacctcctccatcctg
gtggagtcagtgaccaggtcctcgacggagacgtgctacagcgccatccccaaggcatcc
tcagacgccagcaaggtgacctccaagggcgcagggctctcgaaggccttcctgggccag
aagagctccttcctggtggactgcagcaaagccggttccaacatgttgctgatcggggtc
cacgggcccaccaccccctgcgaagaagtctccatgaagcatgtgggcaaccagcagtac
aacgtgacctacgtcgtcaaggagcggggggattacgtcctggccgtgaagtggggagag
gagcacatccccggcagtccgttccacgtcaccgtgccttaa

DBGET integrated database retrieval system