KEGG   Bos taurus (cow): 613533Help
Entry
613533            CDS       T01008                                 

Gene name
FLNB
Definition
(RefSeq) filamin B
  KO
K04437  
filamin
Organism
bta  Bos taurus (cow)
Pathway
MAPK signaling pathway
Focal adhesion
Salmonella infection
Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:bta00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    613533 (FLNB)
 Cellular Processes
  Cellular community - eukaryotes
   04510 Focal adhesion
    613533 (FLNB)
 Human Diseases
  Cancers
   05205 Proteoglycans in cancer
    613533 (FLNB)
  Infectious diseases
   05132 Salmonella infection
    613533 (FLNB)
Cytoskeleton proteins [BR:bta04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Cross-linking proteins
     613533 (FLNB)
  Intermediate filaments
   Intermediate filament-binding proteins
    613533 (FLNB)
Exosome [BR:bta04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   613533 (FLNB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
BGD-bta: 
Ensembl: 
UniProt: 
Position
22
AA seq 2633 aa AA seqDB search
MPVTEKDLAEDAPWKKIQQNTFTRWCNEHLKCVNKRIGNLQTDLSDGLRLIALLEVLSQK
HMYRKYHQRPTFRQMQLENVSVALEFLDRESIKLVSIDSKAIVDGNLKLILGLVWTLILH
YSISMPVWEDEGDDDAKKQTPKQRLLGWIQNKIPYLPITNFNQNWQDGKALGALVDSCAP
GLCPDWESWDPRKPVDNAREAMQQADDWLGVPQVITPEEIIHPDVDEHSVMTYLSQFPKA
KLKPGAPLKPKLNPKKARAYGRGIEPTGNMVKQPAKFTVDTISAGQGDVMVFVEDPEGNK
EEALVTPDSDKNKTYSVEYLPKVTGLHKVTVLFAGQHISKSPFEVNVDKAQGDASKVTAK
GPGLEVASNIANKPTYFDIYTAGAGVGDIGVEVEDPQGKNTVELLVEDRGNQVYRCVYKP
MQPGPHVVKVSFAGDTIPKSPFVVQVGEACNPNACRASGRGLQPKGIRIRETADFKVDTK
AAGSGELGVTIKGPKGLEELVKQKGFQDGVYAFEYYPSTQGKYSVSITWGGHHIQKSPFE
VQVGPEAGMQKVRAWGPGLHGGIVGRSADFVVESIGSEVGSLGFAIEGPSQAKIEYDDQN
DGSCDVKYWPKEPGEYAVHIMCDDEDIKDSPFMAYIHPASGDYNPDLVQAYGPGLEKSGC
IVNNLAEFTVDPKDAGKAPLKIFAQDGDGQPIDIQMKSRMDGTYACSYTPVKAIKHTIAV
VWGGVNIPHSPYRVSIGQGSHPQKVKVFGPGVERSGLKAHEPTHFTVDCTEAGEGDVSVG
IKCDARVLSDEEEDVDFDIIHNANDTFTVKYVPPAAGRYTIKVLFASQEIPTSPFRVKVD
PSHDASKVKAEGPGLSKAGVENGKPTHFTVYTKGAGKAPLNVQFSSPGPGDAVKDLDIID
NYDYSHTVKYTPTQQGNMQVLVTYGGDPIPKSPFTVGVAAPLDLSRIKINGLENRVEVGK
DQEFAVDTRGAGGQGKLDVTILSPSRKVVPCLVAPMAGREGSTAKFIPREEGLYAIDLTY
DGHPVPGSPYVVEASLPPDPTKVKAHGPGLRGGLVGKPAEFTIDTKGAGTGGLGLTVEGP
CEAKIECSDNGDGTCSVSYLPTKPGEYFVNILFEEVHIPGSPFKADIEMPFDPSKVVASG
PGLEHGKVGEPGLLSVDCSEAGPGTLGLEAVSDSGAKAEVCIENNKDGTYAVTYVPLTAG
MYTLTMKYGGELVPHFPTRVKVEPAVDTSRVKVFGPGIEGKDVFREATTDFTVDSRPLTQ
VGGDHIKAHIANPSGASTECFVTDNADGTYQVEYTPFEKGLHVVEVTYDDVPVPNSPFKV
AVTEGCQPSRVQAQGPGLKEAFTNKPNVFTVVTRGAGIGGLGITVEGPSESKINCRDNKD
GSCSAEYVPFAPGDYDVNITYGGAHIPGSPFRVPVKDVVDPSKVKIVGPGLGSGVRARVL
QSFTVDSSKAGLAPLEVRVMGPRADQTISWSRRSPLKAISGFFKRDRKGDFMETGLVEPV
NVVDNGDGTHTVTYTPSQEGPYMVSVKYADEEIPRSPFKVKVLPTYDASKVTASGPGLST
YGVPASLPVEFAIDARDAGEGLLAVQITDQEGKPKRAIVHDNKDGTYAVTYIPDKTGRYM
IGVTYGGDDIPLSPYRIRATQTGDASKCLATGPGIASTVKTGEEVGFVVDAKTAGKGKVT
CTVLTPDGTEAEADVIENEDGTYDIFYTAAKPGTYVIYVRFGGVDIPNSPFTVMATDGEV
AAVKEVPVNACPPGFRPWVTEEAYVPVSNMNGLGFKPFDLVIPFAVRKGEITGEVHMPSG
KTAKPEIVDNKDGTVTVRYAPTEVGLHEMHIKYMGSHIPESPLQFYVNYPNSGSVSAYGP
GLVYGVANKTATFTIVTEDAGEGGLDLAIEGPSKAEISCIDNKDGTCTVTYLPTLPGDYS
ILVKYNDKHIPGSPFTAKITDDSRRCSQVKLGSAADFLLDISETDLSTLTASIKAPSGRD
EPCLLKRLPNNHIGISFIPREVGEHLVSIKKNGNHVANSPVSIMVVQSEIGDARRAKVYG
RGLSEGRTFEMSDFIVDTRDAGYGGISLAVEGPSKVDIQTEDLEDGTCKVSYFPTVPGVY
IVSTKFADEHVPGSPFTVKISGEGRVKESITRTSRAPSVATVGSICDLNLKIPEIDSSDM
SAHVTSPSGRVTEAEIVPVGKNSHCVRFVPQEMGVHTVSVKYRGQHVTGSPFQFTVGPLG
EGGAHKVRAGGPGLERGEAGVPAEFSIWTREAGAGGLSIAVEGPSKAEITFDDHKNGSCG
VSYIAQEPGNYEVSIKFNDEHIPESPYVVPVIAPSDDARRLTVLSLQESGLKVNQPASFA
IRLNGAKGKIDAKVHSPSGAVEECHVSELEPDKYAVRFIPHENGIHTIDVKFNGSHVVGS
PFKVRVGEPGQAGNPALVSAYGAGLEGGSTGIQSEFFINTTRAGPGTLSVTIEGPSKVKM
DCQETPEGYKVMYTPMAPGNYLIGVKYGGPNHIVGSPFKAKVTGQRLVSPGSANETSSIL
VESVTRSSTETCYSAIPKASSDASKVTSKGAGLSKAFLGQKSSFLVDCSKAGSNMLLIGV
HGPTTPCEEVSMKHVGNQQYNVTYVVKERGDYVLAVKWGEEHIPGSPFHVTVP
NT seq 7902 nt NT seq  +upstreamnt  +downstreamnt
atgcccgtaaccgagaaggacctggcggaggacgcgccctggaagaagatccagcagaac
accttcacgcgttggtgcaacgagcaccttaagtgcgtgaacaagcgcatagggaacctg
cagaccgacctgagcgacgggctgcggctcatcgcgctcctggaggtgctcagccagaag
cacatgtaccgcaagtaccaccagcggcccaccttccgccagatgcagctggagaacgtg
tccgtggcgctcgagttcctggaccgcgagagcatcaagctcgtgtccatcgacagcaaa
gccatcgtggatgggaacctgaagctcatcttgggcctggtgtggacgctcatcctccac
tactccatctccatgcccgtgtgggaggatgaaggagacgatgatgccaagaagcagacg
ccaaagcagaggctgcttgggtggattcagaacaagatcccctacttgcccatcaccaac
ttcaaccaaaactggcaagacggcaaagccctgggagccttggtagacagttgtgctcca
ggtctttgcccagactgggaatcctgggatccacgaaagcctgtggataatgcacgagaa
gccatgcagcaggcagacgactggctaggcgtcccacaggtcatcactcctgaagaaatt
attcacccggatgtggatgaacactcagtgatgacttacctgtcccagttccccaaagcc
aagctcaagcctggagctccccttaaacccaaactcaaccccaagaaagccagggcctat
ggtagaggtatcgagcccactgggaacatggtgaagcagccggccaagttcaccgtggac
acaatcagcgccgggcaaggtgatgtcatggtgtttgttgaggacccagaagggaacaaa
gaggaggcactcgtgacccctgacagcgataagaacaagacatactctgtggagtatctg
cccaaggtcactggactgcacaaagtcacagtcctctttgcaggacagcacatctccaag
agcccattcgaggtgaatgtcgacaaggcccagggagatgccagtaaagtcactgcgaaa
ggcccaggcttggaagttgccagcaacatcgccaataagcccacctattttgacatctac
acagcaggtgctggcgtgggcgacattggtgtggaggtggaggatccccaggggaagaac
accgtggagttgctcgtggaagacagaggaaaccaagtgtatcgatgtgtgtacaaacca
atgcagcctggcccccacgtggtcaaggtttcctttgctggggacaccatccccaagagt
cccttcgttgttcaggttggggaagcctgcaatccaaacgcctgccgggccagtggccga
ggcctgcagcctaaaggcattcgcatccgagaaactgcagacttcaaggttgacaccaaa
gctgctggaagtggagagctcggcgtcaccattaagggtcctaagggtctggaggagctg
gtgaaacagaaaggctttcaggatggagtctatgcatttgagtattaccccagcacccag
gggaaatacagcgtctccatcacgtggggaggacaccacattcaaaagagcccttttgaa
gttcaagttggccctgaagcaggcatgcagaaagtccgtgcatggggacctggcctccac
ggcgggattgttgggcggtcagcggacttcgttgtggagtccattggttctgaagtgggg
tctctggggtttgccattgaaggcccctcccaggcgaagattgaatatgacgaccagaat
gacgggtcatgtgatgtcaagtactggcccaaggagccgggcgaatatgccgttcacatc
atgtgcgacgatgaggacatcaaggacagtcccttcatggcctacatccacccggcctcg
ggagactacaacccggacctggtgcaagcatacgggccaggtttggagaaatccggatgc
attgtcaacaacctggctgagttcaccgtggatcctaaggatgccggaaaagctccctta
aagatatttgctcaggacggggacggccagcctattgacatccagatgaagagccggatg
gatggcacctacgcctgctcatacaccccagttaaggccatcaagcacaccattgccgtg
gtctggggaggtgtcaacatcccgcacagcccttaccgggtcagcatcggacagggtagc
catccccagaaggtcaaagtgtttgggccaggagtggagagaagtggactgaaggcacac
gagcctactcacttcaccgtggactgtactgaggctggcgaaggtgatgtcagcgttggc
attaaatgtgatgcccgggtgttaagtgacgaggaggaagacgtggattttgacattatt
cacaacgccaatgatacatttactgtcaaatatgtgcctcctgctgccgggcgatacacc
atcaaagttctctttgcctctcaggaaatccccaccagccctttcagagtcaaggtcgac
ccttcccacgatgccagcaaagtgaaggcagaaggcccagggctcagcaaagcaggtgtg
gaaaacgggaaacccacccacttcactgtgtacaccaagggggctggaaaggccccgctc
aacgtgcagttcagcagccctggccctggcgacgccgtgaaggatctggatatcatcgat
aactatgactactctcacaccgttaaatacacacccacccagcagggcaacatgcaggtt
ctggttacatacggtggtgaccctatccctaagagcccattcactgtgggtgtggctgct
ccgctggatctgagcaggataaaaattaatggactggaaaacagagtcgaagttgggaag
gaccaggagttcgccgtggacaccaggggagcaggaggccaggggaagctggacgtgacg
atcctgagcccctcaaggaaggtcgtgccgtgtctggtggcacccatggcaggccgggag
ggcagcacagccaagttcatcccacgggaggaagggctgtatgccatcgacttgacctat
gacggacatcctgtgcccggaagcccttacgtggtggaggcctcgctgccacctgatccc
accaaggtgaaggcccatggtcctggcctcagaggtggtcttgtgggcaagcctgccgag
ttcaccatcgacaccaaaggagctggaactggaggtctcggcctaaccgtggaaggccca
tgcgaggccaaaattgaatgctcagacaacggcgatgggacctgttctgtctcctacctc
ccgacaaagcccggggagtacttcgtcaacattctcttcgaagaagtccacatacctggc
tctcccttcaaagccgacattgaaatgccttttgacccctccaaagtcgtggcgtccggc
ccgggcctcgagcatgggaaggtgggcgagcccgggctgctcagcgtggactgttcagaa
gctgggccagggaccctgggcctggaagctgtctcggactcaggggcaaaagccgaagtc
tgtatcgagaacaacaaagatggtacctatgcggtgacctatgtgcccctgacggccggc
atgtacacgctgaccatgaagtacggcggggagctggtgccacacttccccaccagggtc
aaggtggagcccgccgtggacaccagtagggtcaaagtctttgggccgggaatagaagga
aaagacgtgtttcgtgaagccaccaccgatttcacggtggactcacggcccctgacgcag
gtcggaggcgaccacatcaaggcccacattgccaacccctccggagcctccacggagtgt
ttcgtcacagacaatgctgatgggacctaccaggtggaatacacgcccttcgagaaaggc
cttcacgtagtggaggtaacctacgatgacgtgcctgtcccaaatagtccctttaaagtg
gccgtgaccgaaggctgccagccttctcgggttcaagctcaaggacctggattgaaggag
gctttcaccaacaagcccaacgttttcacggtggttaccagaggggcaggaattgggggt
ctcggcataactgtggagggaccgtccgagtcaaagataaactgcagagacaacaaagat
ggcagctgcagtgcagagtacgttccctttgctccgggagattacgacgtgaatatcaca
tacggaggtgcccacattcctggcagccccttcagggttcctgtgaaggatgttgtggac
cccagcaaggtcaagatcgttggccctgggctgggctccggtgtccgagctcgcgtcttg
cagtccttcacggtggacagcagcaaggctggcctggcccctctggaagtgagggtcatg
ggtccacgagctgatcagacgatttcctggtcaaggcgcagccccttgaaagccatttca
gggttctttaagcgtgaccggaagggtgactttatggagacaggcctggtggagccagtg
aacgtggtggacaatggcgatggcacacacacagtgacctacaccccatcccaggagggc
ccttacatggtctctgttaagtacgcggacgaagagatcccgcgtagtccctttaaggtc
aaggtccttcccacatacgatgccagcaaagtgaccgccagtggtcctggcctcagtacc
tacggtgtgcctgccagcctgcctgtggagtttgccatcgatgccagagatgctggggaa
ggcctgcttgctgttcagataacggaccaagaggggaaacccaaaagagccattgtccac
gataataaagatggcacatatgccgtcacttacatcccggacaagactggacggtatatg
attggggtcacctacggtggggatgacatcccattgtctccctaccgcatccgggccaca
cagacgggtgatgccagcaagtgcctggccacggggcctggaatcgcctctactgtgaaa
accggcgaggaagtgggctttgtggtcgatgccaagaccgccgggaagggcaaagtgact
tgcacagttttgaccccagacggcaccgaggctgaggccgatgtcatcgagaatgaggac
ggcacctatgacatcttctacacagctgccaagccgggcacctacgtcatctatgtgcgc
tttggtggcgtcgacattcccaacagtcccttcactgtcatggccacagatggggaagtc
gcagctgtgaaggaagtaccggtaaatgcatgtccccctggattcaggccctgggtaaca
gaagaggcctatgtcccagtgagcaacatgaacggcctgggatttaagcctttcgacttg
gtcattccatttgcagtcaggaaaggagaaatcaccggagaggtccacatgccttccggg
aagacggccaagcccgagattgtggacaacaaggacggcacagtcactgtcagatacgcc
cccacggaggttggcctccacgagatgcacatcaagtacatgggcagccacattcctgag
agccccctccagttctacgtgaactaccccaacagtgggagcgtgtctgcgtacggccca
ggcctggtgtacggagtggccaacaaaaccgccaccttcaccatcgtcaccgaagacgcc
ggagaaggtggcctggacttggctatcgagggaccctcaaaggccgaaatcagctgtatt
gacaacaaagatgggacgtgcacggtgacttacctgcccaccttgccgggcgactacagc
atcctggtcaagtacaatgacaaacacatccctggcagccccttcacagccaagatcaca
gacgacagcagacggtgctctcaggtgaagctgggctcagccgccgacttcttgcttgac
atcagcgagactgacctcagcaccttgacggccagcatcaaggccccgtccggtcgtgac
gagccttgtctcctgaagaggctgcccaacaatcacatcggcatctccttcattccccgg
gaggtgggtgaacacctggtcagcatcaagaagaacggcaaccacgtggccaacagcccc
gtatccatcatggtggtccagtcggagattggggatgcccgcagagccaaagtctatggc
cgtggcctgtcagaaggccggactttcgagatgtctgacttcattgtggacacgagagat
gcaggttacggaggcatctccttggcggtggaaggccctagcaaggtggacatccagacc
gaggacctggaggacggcacctgcaaggtctcctacttccccactgtgcctggggtttat
atcgtctccaccaagttcgctgacgagcacgtgcctgggagcccgttcaccgtgaaaatc
agcggggagggaagagtcaaggagagcatcacccgtaccagccgagccccgtctgtggcc
actgttggcagcatctgtgacctgaacctgaaaatcccagaaattgacagcagtgacatg
tcagcccacgtcaccagcccctctggccgcgtgaccgaggcggagatcgtgccggtgggg
aagaactcgcactgcgtccggttcgtgccccaggagatgggcgttcacaccgtcagcgtc
aagtaccgtggccagcacgtcactggcagccccttccagttcactgtggggccgctgggc
gaggggggtgcccacaaggtccgggcaggcggccctggcctggagcgaggagaagccgga
gttccggcggagttcagcatctggacccgggaggcaggcgccgggggcctctccatcgcc
gtggagggccccagtaaggccgagattacattcgatgaccataaaaacggatcttgtggt
gtgtcttatattgcccaggaacctggtaactacgaggtctccatcaagttcaatgacgag
catattcccgaaagtccctatgtggtgccggtgatcgcgccctcggacgacgcccgccgc
ctcactgttctgagccttcaggaatcgggattaaaagttaatcagccagcctcctttgct
ataaggttgaacggggcaaaaggcaagatcgatgcaaaggtgcacagcccctctggagcc
gtggaggaatgccacgtgtctgagctggagccagataagtatgctgttcgcttcatcccc
cacgagaatggtatccacacgattgacgtcaagttcaacgggagccacgtggttggaagt
cccttcaaagtgcgcgtcggggagcctggacaagcggggaaccccgccctggtgtcggcc
tatggcgcagggcttgagggaggctccacaggtatccagtcagaatttttcatcaatacc
acccgagcagggccagggacattatccgtcaccatcgaagggccgtccaaggttaaaatg
gattgccaggaaacccccgaagggtacaaggtcatgtacacccccatggctcctggaaac
tacctgattggcgtcaaatatggcgggcccaaccacatcgtgggcagcccgttcaaggcc
aaggtgacaggccagcgtctggtcagccccggctcggccaacgagacctcctccatcctg
gtggagtcagtgaccaggtcctcgacggagacgtgctacagcgccatccccaaggcatcc
tcagacgccagcaaggtgacctccaagggcgcagggctctcgaaggccttcctgggccag
aagagctccttcctggtggactgcagcaaagccggttccaacatgttgctgatcggggtc
cacgggcccaccaccccctgcgaagaagtctccatgaagcatgtgggcaaccagcagtac
aacgtgacctacgtcgtcaaggagcggggggattacgtcctggccgtgaagtggggagag
gagcacatccccggcagtccgttccacgtcaccgtgccttaa

DBGET integrated database retrieval system