KEGG   Bos taurus (cow): 613808Help
Entry
613808            CDS       T01008                                 

Gene name
CLK1
Definition
CDC-like kinase 1 (EC:2.7.12.1)
Orthology
K08823  
CDC-like kinase [EC:2.7.12.1]
Organism
bta  Bos taurus (cow)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
Ensembl: 
UniProt: 
Position
2
AA seq 347 aa AA seqDB search
MIAFIISKLFSFLGITEFYFSLLDEIVDTLGEGAFGKVVECIDHKAGGRHVAVKIVKNVD
RYCEAARSEIQVLEHLNTTDPSSTFRCVQMLEWFEHHGHVCIVFELLGLSTYDFIKENGF
LPFRLDHIRRMAYQICKSVNFLHSNKLTHTDLKPENILFVQSDYTEAYNPKMKRDERTLI
NPDIKVVDFGSATYDDEHHSTLVSTRHYRAPEVILALGWSQPCDVWSIGCILIEYYLGFT
VFPTHDSKEHLAMMERILGPLPKHMIQKTRKRKYFHHDRLDWDEHSSAGRYVSRRCKPLK
EFMLSQDAEHELLFDLIQKMLEYEPAKRITLKEALKHPFFYPLKKAT
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgatagcctttattataagtaaactcttttcatttcttggtataactgagttttatttc
tctcttttagatgaaattgttgatactttaggtgaaggagcttttggaaaagttgtggag
tgcattgatcataaagcgggaggtagacatgtagcagtaaaaatagttaaaaatgtggat
agatattgtgaagcagctcgctcagaaatacaagttctggaacacttaaatacaacagac
cctagcagtacattccgctgtgtccagatgttggagtggtttgagcatcatggtcatgtc
tgcattgtgtttgaactattgggacttagtacttatgactttattaaggaaaatggtttt
ctgccctttcgactggatcatatcaggaggatggcataccagatatgcaagtctgtgaac
tttttgcacagtaataagttgactcacacagacttaaaacctgaaaacatcttatttgta
cagtctgactacacagaggcatataatcccaaaatgaaacgtgatgaacgtactttaata
aatccagatattaaagttgtagacttcggaagtgcaacatatgatgatgaacatcacagt
acattggtatctacaagacattatagggcacctgaagttatattagctttaggatggtcc
cagccatgtgatgtctggagtataggatgtattcttattgaatattaccttggatttaca
gtatttccaacgcatgatagtaaggaacatttggcaatgatggaaaggattcttgggcct
ttaccaaaacatatgatacagaaaaccaggaaacgtaaatatttccatcatgatcgatta
gactgggatgaacatagttctgctggcagatacgtttcaaggcgttgtaaacctctgaag
gaatttatgctttcccaagatgctgaacatgagcttctctttgaccttattcagaaaatg
ttggagtatgaaccagctaaaaggatcactcttaaagaagccttaaagcatcctttcttt
tacccccttaaaaaagctacataa

DBGET integrated database retrieval system