KEGG   Bos taurus (cow): 613854Help
Entry
613854            CDS       T01008                                 

Gene name
PCMT1
Definition
protein-L-isoaspartate (D-aspartate) O-methyltransferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
bta  Bos taurus (cow)
Brite
Enzymes [BR:bta01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     613854 (PCMT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
Ensembl: 
UniProt: 
Position
9
AA seq 227 aa AA seqDB search
MAWKSGGASHSELIHNLRKNGIIKTDKVFEVMLATDRSHYAKCNPYMDSPQSIGFQATIS
APHMHAYALELLFDQLNEGAKALDVGSGSGILTACFARMVGPSGKVIGIDHIKELVDDSI
NNVRKDDPMLLSTGRVQLVVGDGRMGYAAEAPYDAIHVGAAAPVVPQALIDQLKPGGRLI
LPVGPAGGNQMLEQYDKLQDGSVKMKPLMGVIYVPLTDKEKQWSRWK
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atggcctggaaatccggcggcgccagccactcggagctaatccacaacctccgcaaaaat
ggaatcatcaagacagataaagtgtttgaagtaatgttggccacagaccgctcccactat
gcaaaatgtaacccttatatggattctccacaatcaatagggttccaagcaacaatcagt
gctccacacatgcatgcatatgcactagaacttctatttgatcagttgaatgaaggagct
aaagctcttgatgtaggatctggaagtggaatccttactgcatgttttgcacgtatggtt
ggacctagtgggaaagtcataggaattgaccacattaaagagctagtagatgactcaata
aataatgtcagaaaggatgatccaatgcttttgtctacagggagggtgcaactggttgtg
ggggatggacgaatgggatatgccgcagaagccccttatgatgctattcacgtaggagct
gcagccccagttgtgccccaggcactaatagaccagttaaagcctggtggaagattgata
ttgccagttggtcctgcaggtggaaaccagatgttggagcagtatgacaagctgcaagat
ggcagtgtcaaaatgaaacctctgatgggagtgatatacgtgcctttaacagataaagaa
aagcagtggtccaggtggaagtga

DBGET integrated database retrieval system