KEGG   Bos taurus (cow): 614077Help
Entry
614077            CDS       T01008                                 

Gene name
PTPN7
Definition
protein tyrosine phosphatase, non-receptor type 7 (EC:3.1.3.48)
Orthology
K18019  
tyrosine-protein phosphatase non-receptor type 7 [EC:3.1.3.48]
Organism
bta  Bos taurus (cow)
Pathway
MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:bta00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    614077 (PTPN7)
Enzymes [BR:bta01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     614077 (PTPN7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
Ensembl: 
UniProt: 
Position
16
AA seq 312 aa AA seqDB search
MLDVRSLGAVEPICSVRTPQEVTLHFLRTAGRPLSRQALQHRPPSPTQLEEEFLRIPSNF
VSPEDLDIPGHASKDRYKTILPNPQSRVCLGRAQSQEDGDYINANYIRGYDGQDKAYIAT
QGPMPNTVSDFWEMVWQEEAPLIIMLTQLREGKEKCVHYWPTEEETYGPFRIRVQDVRER
PEYTVRTLTIQHQEQRRALKHILFSAWPDHQTPESAGPLLRLVAEVEDGPETGARSGPIV
VHCSAGIGRTGCFIATRIGCQQLKARGEVDILSIVCQLRLDRGGMIQTAEQYQFLHHTLA
LFAAQLPEEPSP
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgctggacgtgcggtccctgggggctgtggagcccatctgctccgtgcgcacgccccag
gaggtcacgctgcacttcctgcgcaccgccgggcggcccctcagccggcaggccctgcag
caccggccacccagtcccacacagctggaagaggaattcctgaggatcccctcaaacttc
gtcagccccgaagacctggatattcctggccatgcctccaaggaccgatataagaccatc
ttgcccaacccccagagccgagtctgtctgggtcgggcacagagccaggaggatggggat
tacatcaatgccaactacattcggggctacgacgggcaggacaaggcctacattgccacc
cagggccccatgcccaacacagtgtcggacttctgggagatggtgtggcaggaagaggcg
cccctcatcatcatgctcacacagctccgagagggcaaggagaagtgcgtccactactgg
cccacagaggaggagacctacgggcccttccgcatccgcgtccaggacgtgcgggagcgc
ccggagtacaccgtgcggacgctcaccatccagcaccaggagcagcgccgggccctgaag
cacattctcttctcggcctggcccgaccaccagaccccggagtcggcggggcccctgctg
cgcctggtggccgaggtggaggacggcccagagactggggcccgctctgggcccatcgtg
gttcactgcagcgcagggatcggccggactggctgcttcatcgccacccgcatcggctgc
caacagctgaaggcccgaggggaggtggacatcctgagcatcgtgtgccagctgcggctg
gacaggggaggcatgatccagacggcagagcagtaccagttcctgcaccacaccctggcc
ttgttcgcagcccagctgccagaggagcccagcccctga

DBGET integrated database retrieval system