KEGG   Bos taurus (cow): 614376Help
Entry
614376            CDS       T01008                                 

Definition
histone cluster 2, H2be-like
Orthology
K11252  
histone H2B
Organism
bta  Bos taurus (cow)
Pathway
Alcoholism
Viral carcinogenesis
Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:bta00001]
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    614376
  Immune diseases
   05322 Systemic lupus erythematosus
    614376
  Substance dependence
   05034 Alcoholism
    614376
Exosome [BR:bta04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   614376
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
Position
3
AA seq 130 aa AA seqDB search
MQECGYSLQMXKKPNAKGSKKAVTKAQKKDGKKHKRSCRGSYSVYMYKVLKQVHLETGFS
SMAMGIMNSFLNDIFQCIAGKTSRLAHYNKRSTITSREIQTAVCLLLPGELAKHAVSKGT
KAVTKYTSSK
NT seq 393 nt NT seq  +upstreamnt  +downstreamnt
atgcaagaatgtggctacagcttacagatgtgaaagaagccaaatgcaaagggctctaaa
aaagctgtgaccaaggcccagaagaaggacggcaagaagcacaagcgcagctgcaggggg
agctactccgtgtacatgtacaaggtgctgaagcaggtccatctggaaaccggcttctcg
tccatggccatgggaatcatgaactccttcctcaacgacattttccagtgcatcgctggc
aagacatcgcgcctggcgcattacaacaagcgctcgactatcacatccagggagatccag
actgccgtgtgcttgctgctacctggggagctggccaagcatgccgtgtccaagggcact
aaggctgtcaccaagtataccagctccaagtaa

DBGET integrated database retrieval system