KEGG   Bos taurus (cow): 614376Help
Entry
614376            CDS       T01008                                 

Definition
(RefSeq) histone H2B
  KO
K11252  histone H2B
Organism
bta  Bos taurus (cow)
Pathway
bta05034  Alcoholism
bta05203  Viral carcinogenesis
bta05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:bta00001]
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    614376
  Immune diseases
   05322 Systemic lupus erythematosus
    614376
  Substance dependence
   05034 Alcoholism
    614376
Chromosome [BR:bta03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histones
    614376
Exosome [BR:bta04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   614376
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Histone CBFD_NFYB_HMF TFIID_20kDa
Motif
Other DBs
NCBI-GeneID: 614376
NCBI-ProteinID: XP_010802071
BGD-bta: BT15101
Position
3
AA seq 85 aa AA seqDB search
MYKVLKQVHLETGFSSMAMGIMNSFLNDIFQCIAGKTSRLAHYNKRSTITSREIQTAVCL
LLPGELAKHAVSKGTKAVTKYTSSK
NT seq 258 nt NT seq  +upstreamnt  +downstreamnt
atgtacaaggtgctgaagcaggtccatctggaaaccggcttctcgtccatggccatggga
atcatgaactccttcctcaacgacattttccagtgcatcgctggcaagacatcgcgcctg
gcgcattacaacaagcgctcgactatcacatccagggagatccagactgccgtgtgcttg
ctgctacctggggagctggccaagcatgccgtgtccaagggcactaaggctgtcaccaag
tataccagctccaagtaa

DBGET integrated database retrieval system