KEGG   Bos taurus (cow): 614570Help
Entry
614570            CDS       T01008                                 

Gene name
EIF4E1B
Definition
eukaryotic translation initiation factor 4E family member 1B
Orthology
K03259  
translation initiation factor 4E
Organism
bta  Bos taurus (cow)
Pathway
RNA transport
HIF-1 signaling pathway
mTOR signaling pathway
PI3K-Akt signaling pathway
Insulin signaling pathway
Module
eIF4F complex
Class
Genetic Information Processing; Translation; RNA transport [PATH:bta03013]
Environmental Information Processing; Signal transduction; HIF-1 signaling pathway [PATH:bta04066]
Environmental Information Processing; Signal transduction; PI3K-Akt signaling pathway [PATH:bta04151]
Environmental Information Processing; Signal transduction; mTOR signaling pathway [PATH:bta04150]
Organismal Systems; Endocrine system; Insulin signaling pathway [PATH:bta04910]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
7
AA seq 198 aa AA seqDB search
MGEEALRKTPEEGKPDLHPLLNRWALWFFKNDRSRAWQNNLHRVTKFNTVEDFWAIYNNI
QLASKLSSGCDYALFKDGIKPMWEDSRNKRGGRWLVSLTKQQRHIELDHLWLETLLCLIG
ESFGEHSQEVCGAVINIRAKGDKIAVWTREAENQEGVLHIGRVYKERLGLSTKTIIGYQA
HADTATKSNSLAKNKFVV
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgggagaggaggctctgaggaagaccccggaggagggcaagccggacttacacccgctg
ctcaacaggtgggctctgtggttcttcaagaatgaccgcagccgagcctggcagaacaac
ctgcatcgggtcaccaagttcaacaccgtggaggacttctgggcgatatataataatatc
cagctggccagtaagctctcttccggctgtgactacgccctgttcaaggatggcattaag
cccatgtgggaagacagcaggaataagcggggtggccgctggctggtcagcctcacaaag
cagcagcgccacattgagctggaccacctgtggctggagacactgctgtgtctcatcggg
gagagctttggggagcacagccaggaagtatgtggggccgtcatcaacatccgagccaag
ggggacaagattgctgtgtggacacgggaggcagagaaccaggaaggcgtgctacacatt
gggcgtgtctacaaagagcgcctgggcctctccacaaagaccatcattgggtaccaggcc
cacgcagacacagccaccaagagcaactccttagccaagaacaaatttgtggtgtga

DBGET integrated database retrieval system