KEGG   Bos taurus (cow): 614612Help
Entry
614612            CDS       T01008                                 

Gene name
SRD5A1, S5AR_1
Definition
(RefSeq) steroid 5 alpha-reductase 1
  KO
K12343  3-oxo-5-alpha-steroid 4-dehydrogenase 1 [EC:1.3.1.22]
Organism
bta  Bos taurus (cow)
Pathway
bta00140  Steroid hormone biosynthesis
Brite
KEGG Orthology (KO) [BR:bta00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    614612 (SRD5A1)
Enzymes [BR:bta01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.22  3-oxo-5alpha-steroid 4-dehydrogenase (NADP+)
     614612 (SRD5A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Steroid_dh DUF1295 PEMT
Motif
Other DBs
NCBI-GeneID: 614612
NCBI-ProteinID: NP_001092607
BGD-bta: BT22366
Ensembl: ENSBTAG00000015478
UniProt: A5PJS2
Position
20
AA seq 257 aa AA seqDB search
MELAERFLLDALAYLECALGVVCYVLLKLVGSPYGRYASSGSAFGLPARAAWTVQELPSL
ALPLLACAGAGAPAERLNRWPNCILLAMFLVHYAQRSLVFPFLIRGGKPMPLYAFLLAFI
FCTYNGYLQSRYLSQYAVYADDWLSDPRFLTGSALWLIGMLINIHSDHVLRNLRKPGETG
YKIPRGGLFEYISAANYFGEVVEWCGYALASWSIQGWAFAVFTFCVLFTRAQQHHKWYHE
KFEDYPKFRKIMIPFLV
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atggagctggccgagcggttcctgctggacgcgctcgcctacctggaatgcgccctgggc
gtcgtgtgctacgtgctgctgaagctggtgggctcgccctacgggcgctacgcgtcgtcc
ggctctgccttcgggctgccggcgcgggccgcctggactgtgcaggagctgccctcgctg
gccctgccgctcctcgcgtgcgcgggcgcaggcgcgccggccgagcgcctcaaccgctgg
cccaactgcatcctcctggccatgttcctcgtccactatgcgcaacggagcttggttttc
ccatttctgatccgaggagggaagcccatgccgctgtatgccttcctattggcgttcatc
ttctgcacctataacggctacctgcagagcaggtacctgagtcagtacgcagtgtacgcg
gacgactggctcagcgacccccggtttctaacaggttctgccttgtggttgataggcatg
ctgattaacatccactcagatcatgtcctgaggaacctcaggaaaccaggggaaactggc
tataaaataccaagagggggcttgtttgaatacatatctgcagccaactacttcggagaa
gtcgtggagtggtgcggctatgccctcgccagctggtccattcagggctgggctttcgct
gtgttcaccttctgcgtcctgttcaccagggctcagcaacatcacaagtggtaccatgag
aaatttgaagattatccaaaattcagaaaaatcatgattccatttttggtttaa

DBGET integrated database retrieval system