KEGG   Bos taurus (cow): 614619Help
Entry
614619            CDS       T01008                                 

Definition
(RefSeq) late histone H2B.L4
  KO
K11252  histone H2B
Organism
bta  Bos taurus (cow)
Pathway
bta05034  Alcoholism
bta05203  Viral carcinogenesis
bta05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:bta00001]
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    614619
  Immune diseases
   05322 Systemic lupus erythematosus
    614619
  Substance dependence
   05034 Alcoholism
    614619
Chromosome [BR:bta03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histones
    614619
Exosome [BR:bta04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   614619
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Histone CBFD_NFYB_HMF YscO-like DUF1998
Motif
Other DBs
NCBI-GeneID: 614619
NCBI-ProteinID: XP_010799584
Position
1
AA seq 138 aa AA seqDB search
MGDMYSQGQKQCKENLKSEHVIHLKVLIFSVIDRGYHKGKRSEKQRRKENNSVLIYETVR
KIPDTGISSKAMGIMNSFVNDIFERIAGEASCLVHYNKRSTITSREIQTAMRLLLPGELA
KHAMSEGTKAVTKYTSSK
NT seq 417 nt NT seq  +upstreamnt  +downstreamnt
atgggtgatatgtattcccaagggcagaagcaatgtaaggaaaatctgaaaagtgagcat
gtgatccatttgaaagtcttgatattctcagtcattgacagaggttatcataaaggaaag
agaagtgaaaagcaaaggagaaaagaaaataattctgtgcttatatatgaaacagtacgc
aaaataccagacaccggcatctcgtccaaggccatgggaatcatgaactccttcgtcaac
gacattttcgagcgcatcgctggcgaggcatcgtgcctggtgcattacaacaagcgctcg
actatcacatccagggagatccagaccgccatgcgcttgctgctacctggggagctggcc
aagcacgccatgtccgagggcactaaggctgtcaccaagtataccagctccaagtaa

DBGET integrated database retrieval system