KEGG   Bos taurus (cow): 614834Help
Entry
614834            CDS       T01008                                 

Gene name
CDS2
Definition
CDP-diacylglycerol synthase (phosphatidate cytidylyltransferase) 2 (EC:2.7.7.41)
Orthology
K00981  
phosphatidate cytidylyltransferase [EC:2.7.7.41]
Organism
bta  Bos taurus (cow)
Pathway
Glycerophospholipid metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:bta00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    614834 (CDS2)
 Environmental Information Processing
  Signal transduction
   04070 Phosphatidylinositol signaling system
    614834 (CDS2)
Enzymes [BR:bta01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.41  phosphatidate cytidylyltransferase
     614834 (CDS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
Ensembl: 
UniProt: 
Position
13
AA seq 445 aa AA seqDB search
MTELRQRVAREPEAPPEDKESESEAKADGETASDSESRVEAVTQPPSADDTPEVLNRALS
NLSSRWKNWWVRGILTLAMIAFFFIIIYLGPMVLMMIVMCVQIKCFHEIITIGYNVYHSY
DLPWFRTLSWYFLLCVNYFFYGETVTDYFFTLVQREEPLRILSKYHRFISFTLYLTGFCM
FVLSLVKKHYRLQFYMFGWTHVTLLIVVTQSHLVIHNLFEGMIWFIVPISCVICNDIMAY
MFGFFFGRTPLIKLSPKKTWEGFIGGFFATVVFGLLLSYVMSGYRCFVCPVEYNNDTNSF
TVDCEPSGLFRLQEYNIPGVIQSIIGWKTVRMYPFQIHSIALSTFASLIGPFGGFFASGF
KRAFKIKDFANTIPGHGGIMDRFDCQYLMATFVNVYIASFIRGPNPSKLVQQFLTLRPDQ
QLHIFNTLKSHLTDKGMLTAATEDK
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
atgacggagctgaggcagagggtggcccgcgagccggaagctccgcccgaggacaaggag
tcagagtcagaagcaaaggcagatggagagactgcatcggacagtgaaagcagagtggaa
gctgtcacccaaccaccctctgcagatgatacgccagaggttctcaacagggccctttcc
aacttgtcttcaagatggaagaactggtgggtgagaggcatcctgactttggcgatgatt
gcatttttcttcattatcatttacttgggaccaatggttttaatgatgattgtgatgtgt
gttcagattaagtgtttccatgagattatcactattggctacaatgtgtaccactcctat
gacctgccctggttcagaaccctcagttggtactttctgctatgtgtaaattatttcttc
tatggcgaaacagtgacggattacttcttcactctggtccagagagaggagcctctgcgg
attctcagtaaataccaccgattcatttcctttactctctatttaacaggattctgcatg
tttgtgctgagtctggtcaagaagcattatcgattgcagttctacatgtttggctggacc
catgtaacattactgattgttgtaacacagtcacatcttgttatccacaacctatttgaa
ggaatgatctggttcattgtccccatttcctgtgtgatctgtaatgacatcatggcctat
atgtttggcttcttctttggtcggaccccactcatcaagctgtccccgaagaagacctgg
gaaggcttcattgggggcttctttgctactgtggtctttggccttctgctgtcctatgtg
atgtctgggtacagatgttttgtctgccctgtggagtacaacaatgataccaacagcttc
actgtggactgtgagccctcgggcctgtttcggctgcaggaatacaacattcctggggtg
atccaatcaatcattggctggaaaacagtccggatgtaccccttccagattcacagcatt
gccctctctacttttgcctcgctcatcggccccttcggagggttctttgctagtggattc
aaacgagcctttaaaatcaaagactttgccaataccattcctggccatggaggcatcatg
gatcgctttgactgccagtatctgatggccacctttgtcaacgtgtatattgctagtttt
atcaggggcccaaacccaagtaagctggttcagcagttcctgaccttgaggccagatcag
caactccatatcttcaacacactcaagtctcacctgaccgacaaggggatgctgacagct
gccacagaggacaagtag

DBGET integrated database retrieval system