KEGG   Bos taurus (cow): 614834Help
Entry
614834            CDS       T01008                                 

Gene name
CDS2
Definition
CDP-diacylglycerol synthase (phosphatidate cytidylyltransferase) 2 (EC:2.7.7.41)
Orthology
K00981  
phosphatidate cytidylyltransferase [EC:2.7.7.41]
Organism
bta  Bos taurus (cow)
Pathway
Glycerophospholipid metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:bta00564]
Environmental Information Processing; Signal transduction; Phosphatidylinositol signaling system [PATH:bta04070]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
Ensembl: 
UniProt: 
Position
13
AA seq 445 aa AA seqDB search
MTELRQRVAREPEAPPEDKESESEAKADGETASDSESRVEAVTQPPSADDTPEVLNRALS
NLSSRWKNWWVRGILTLAMIAFFFIIIYLGPMVLMMIVMCVQIKCFHEIITIGYNVYHSY
DLPWFRTLSWYFLLCVNYFFYGETVTDYFFTLVQREEPLRILSKYHRFISFTLYLTGFCM
FVLSLVKKHYRLQFYMFGWTHVTLLIVVTQSHLVIHNLFEGMIWFIVPISCVICNDIMAY
MFGFFFGRTPLIKLSPKKTWEGFIGGFFATVVFGLLLSYVMSGYRCFVCPVEYNNDTNSF
TVDCEPSGLFRLQEYNIPGVIQSIIGWKTVRMYPFQIHSIALSTFASLIGPFGGFFASGF
KRAFKIKDFANTIPGHGGIMDRFDCQYLMATFVNVYIASFIRGPNPSKLVQQFLTLRPDQ
QLHIFNTLKSHLTDKGMLTAATEDK
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
atgacggagctgaggcagagggtggcccgcgagccggaagctccgcccgaggacaaggag
tcagagtcagaagcaaaggcagatggagagactgcatcggacagtgaaagcagagtggaa
gctgtcacccaaccaccctctgcagatgatacgccagaggttctcaacagggccctttcc
aacttgtcttcaagatggaagaactggtgggtgagaggcatcctgactttggcgatgatt
gcatttttcttcattatcatttacttgggaccaatggttttaatgatgattgtgatgtgt
gttcagattaagtgtttccatgagattatcactattggctacaatgtgtaccactcctat
gacctgccctggttcagaaccctcagttggtactttctgctatgtgtaaattatttcttc
tatggcgaaacagtgacggattacttcttcactctggtccagagagaggagcctctgcgg
attctcagtaaataccaccgattcatttcctttactctctatttaacaggattctgcatg
tttgtgctgagtctggtcaagaagcattatcgattgcagttctacatgtttggctggacc
catgtaacattactgattgttgtaacacagtcacatcttgttatccacaacctatttgaa
ggaatgatctggttcattgtccccatttcctgtgtgatctgtaatgacatcatggcctat
atgtttggcttcttctttggtcggaccccactcatcaagctgtccccgaagaagacctgg
gaaggcttcattgggggcttctttgctactgtggtctttggccttctgctgtcctatgtg
atgtctgggtacagatgttttgtctgccctgtggagtacaacaatgataccaacagcttc
actgtggactgtgagccctcgggcctgtttcggctgcaggaatacaacattcctggggtg
atccaatcaatcattggctggaaaacagtccggatgtaccccttccagattcacagcatt
gccctctctacttttgcctcgctcatcggccccttcggagggttctttgctagtggattc
aaacgagcctttaaaatcaaagactttgccaataccattcctggccatggaggcatcatg
gatcgctttgactgccagtatctgatggccacctttgtcaacgtgtatattgctagtttt
atcaggggcccaaacccaagtaagctggttcagcagttcctgaccttgaggccagatcag
caactccatatcttcaacacactcaagtctcacctgaccgacaaggggatgctgacagct
gccacagaggacaagtag

DBGET integrated database retrieval system