KEGG   Bos taurus (cow): 614958Help
Entry
614958            CDS       T01008                                 

Gene name
HIST1H2BB, HIST1H2BM, HIST1H2BN
Definition
histone cluster 1, H2bn
Orthology
K11252  
histone H2B
Organism
bta  Bos taurus (cow)
Pathway
Alcoholism
Viral carcinogenesis
Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:bta00001]
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    614958 (HIST1H2BB)
  Immune diseases
   05322 Systemic lupus erythematosus
    614958 (HIST1H2BB)
  Substance dependence
   05034 Alcoholism
    614958 (HIST1H2BB)
Exosome [BR:bta04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   614958 (HIST1H2BB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
23
AA seq 126 aa AA seqDB search
MPEPSKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAM
GNMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT
KYTSSK
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaaccctcgaagtccgctccggccccgaagaagggctccaagaaggcagtgacc
aaggcgcagaagaaggacggcaagaagcgcaagcgcagccgcaaggagagctactccgtg
tacgtgtacaaggtgctgaagcaggtccacccggacaccggcatctcgtccaaggccatg
ggcaacatgaattcgttcgtgaacgatattttcgagcgcatcgcgggcgaggcgtcgcgc
ctggctcactacaacaagcgctcgaccatcacatccagggagatccagacggccgtgcgc
ctgctgcttcccggagaactggccaagcacgccgtgtctgagggcaccaaggccgtcacc
aagtacaccagttctaagtga

DBGET integrated database retrieval system