KEGG   Bos taurus (cow): 615091Help
Entry
615091            CDS       T01008                                 

Gene name
HIST2H2BF
Definition
histone cluster 2, H2bf
Orthology
K11252  
histone H2B
Organism
bta  Bos taurus (cow)
Pathway
Alcoholism
Viral carcinogenesis
Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:bta00001]
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    615091 (HIST2H2BF)
  Immune diseases
   05322 Systemic lupus erythematosus
    615091 (HIST2H2BF)
  Substance dependence
   05034 Alcoholism
    615091 (HIST2H2BF)
Exosome [BR:bta04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   615091 (HIST2H2BF)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
Position
3
AA seq 166 aa AA seqDB search
MPDPAKSAPAPKKGSKKAVTKVQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAM
GIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT
KYTSSNFYRSTSGYPWMLIHTAEEPLRIRGILENCLQETSQVYRGA
NT seq 501 nt NT seq  +upstreamnt  +downstreamnt
atgccggatccagcaaaatccgctcctgctccaaaaaaaggttctaaaaaggctgtcacg
aaagtgcagaagaaggatggtaagaagcgcaagcgcagccgcaaggagagctattccgtt
tacgtgtataaggtgctgaaacaggtacacccggacaccggcatctcgtccaaggccatg
ggcatcatgaattctttcgtcaatgacattttcgagcgcattgccggcgaagcatcgcgc
ctggcgcattacaacaagcgctcgaccattacttcccgagagatccagacagcggtacgc
ctgctgcttcccggcgagctggctaaacacgccgtgtccgagggcaccaaggcggtcacc
aagtacaccagttcaaacttttacagaagcacttctgggtatccctggatgctaatacac
acagcagaggaacctttaagaatcagaggcattttggagaactgcctgcaggaaacatct
caagtgtacagaggggcatga

DBGET integrated database retrieval system