KEGG   Bos taurus (cow): 615091Help
Entry
615091            CDS       T01008                                 

Gene name
HIST2H2BF
Definition
(RefSeq) histone cluster 2, H2bf
  KO
K11252  histone H2B
Organism
bta  Bos taurus (cow)
Pathway
bta05034  Alcoholism
bta05203  Viral carcinogenesis
bta05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:bta00001]
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    615091 (HIST2H2BF)
  Immune diseases
   05322 Systemic lupus erythematosus
    615091 (HIST2H2BF)
  Substance dependence
   05034 Alcoholism
    615091 (HIST2H2BF)
Chromosome and associated proteins [BR:bta03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histones
    615091 (HIST2H2BF)
Exosome [BR:bta04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   615091 (HIST2H2BF)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Histone CBFD_NFYB_HMF TFIID_20kDa YscO-like
Motif
Other DBs
NCBI-GeneID: 615091
NCBI-ProteinID: XP_010801389
BGD-bta: BT25844
Position
3
AA seq 126 aa AA seqDB search
MPDPAKSAPAPKKGSKKAVTKVQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAM
GIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT
KYTSSK
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgccggatccagcaaaatccgctcctgctccaaaaaaaggttctaaaaaggctgtcacg
aaagtgcagaagaaggatggtaagaagcgcaagcgcagccgcaaggagagctattccgtt
tacgtgtataaggtgctgaaacaggtacacccggacaccggcatctcgtccaaggccatg
ggcatcatgaattctttcgtcaatgacattttcgagcgcattgccggcgaagcatcgcgc
ctggcgcattacaacaagcgctcgaccattacttcccgagagatccagacagcggtacgc
ctgctgcttcccggcgagctggctaaacacgccgtgtccgagggcaccaaggcggtcacc
aagtacaccagttcaaagtaa

DBGET integrated database retrieval system