KEGG   Bos taurus (cow): 615303Help
Entry
615303            CDS       T01008                                 

Gene name
UGT2B4, UGT2B17
Definition
UDP glucuronosyltransferase 2 family, polypeptide B4
Orthology
K00699  
glucuronosyltransferase [EC:2.4.1.17]
Organism
bta  Bos taurus (cow)
Pathway
Pentose and glucuronate interconversions
Ascorbate and aldarate metabolism
Steroid hormone biosynthesis
Starch and sucrose metabolism
Retinol metabolism
Porphyrin and chlorophyll metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Drug metabolism - other enzymes
Metabolic pathways
Chemical carcinogenesis
Module
Glucuronate pathway (uronate pathway)
Ascorbate biosynthesis, animals, glucose-1P => ascorbate
Brite
KEGG Orthology (KO) [BR:bta00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    615303 (UGT2B4)
   00053 Ascorbate and aldarate metabolism
    615303 (UGT2B4)
   00500 Starch and sucrose metabolism
    615303 (UGT2B4)
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    615303 (UGT2B4)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    615303 (UGT2B4)
   00860 Porphyrin and chlorophyll metabolism
    615303 (UGT2B4)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    615303 (UGT2B4)
   00982 Drug metabolism - cytochrome P450
    615303 (UGT2B4)
   00983 Drug metabolism - other enzymes
    615303 (UGT2B4)
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    615303 (UGT2B4)
Enzymes [BR:bta01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     615303 (UGT2B4)
Glycosyltransferases [BR:bta01003]
 Others
  Hydrophobic molecule
   615303 (UGT2B4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
Ensembl: 
Position
6
AA seq 531 aa AA seqDB search
MNMMSMKQLSFLMLLQLTCYFNSGNCGKVLVWPVEYSHWINIKTILDELVSRGHEVTVMT
SSASILINTRKEFGIKFENFPVSLTKGDFEYIFKDLLEKWTYMEKDSFLSYFSAVQSLFW
KYSDVSMKMCKEVVSNKKLITKLQESRFDVLLADAIGPCGELLAEILKVPLVYSLRFSPG
FSIEKYSGGLSFPPSYVPVIMSELSDQMTFMERVKNMIYVLYFDFWFQTFNEKKWNQFYS
EVLGRQTTLSETMGKAEMWLIRTYWDFQFPHPLLPNFEFVGGLHCKPAKPLPKEIEEFVQ
SSGENGIVVFTLGSMITNMTEERANTIASALAQIPQKVLWRYSGKKPDTLGPNTRLYDWI
PQNDLLGHPKTKAFLTHGGTNGIYEAIYHGIPMVGIPLFADQPDNIAHMKAKGAAVSLDL
ETMSTRDLLNALNEVINNPSYKKNVMWLSSIQRDQPMKPLDRAVFWIEFVMRHKGAKHLR
PAAHDLTWYQYHSLDVIGFLLACVATAAFVITKCYLFCYRKFLKTGKKKRE
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atgaatatgatgtctatgaaacagctctcatttctaatgctgctacagctgacttgctac
ttcaactctggaaattgcggaaaggtgctggtgtggccagtggaatatagtcattggata
aatataaagacaattctcgatgaactggtctcaaggggtcatgaggtgactgttatgaca
tcttcagcttccattttgattaataccagaaaagagtttggtatcaaatttgagaatttc
cctgtatctttaactaaaggtgattttgagtatatcttcaaggatttgcttgagaagtgg
acatatatggaaaaagattcatttttgtcatatttttcagcagtgcaaagtttattttgg
aaatattctgatgtgtccatgaagatgtgtaaagaagttgtttcaaacaagaaacttata
acaaaactacaggaatcaaggtttgatgtccttcttgcagatgccattggaccctgtggt
gaactgctagctgagatacttaaagtacctttagtgtacagcctccgtttctctcctggt
ttttcaattgaaaaatatagtgggggcctttcatttccaccatcctatgtacctgttatt
atgtcagaattaagtgatcaaatgacattcatggagagggtaaaaaatatgatatatgta
ctttattttgacttttggttccagacatttaatgagaagaaatggaatcaattttacagt
gaagtactaggaagacagactacattatcagagacaatgggaaaagctgaaatgtggctc
attcgaacctactgggattttcaatttcctcacccattactaccaaattttgaatttgtt
ggaggccttcactgcaaacctgccaaacccctgcctaaggaaatagaagagtttgtccag
agctctggagaaaatggtatcgtggtgtttactttggggtcaatgatcactaacatgaca
gaagaaagagccaatacaattgcatcagcccttgcccagattccacaaaaggtgttatgg
agatacagtggcaaaaaaccagacaccttaggacccaatactcggctgtatgactggatc
ccccagaatgaccttcttggtcatccaaaaaccaaagcctttttaactcatggtggaacc
aatggcatttacgaggccatctaccatgggatccctatggtgggcattcctttgtttgct
gatcaacctgataacatcgctcatatgaaggccaagggagcagctgtcagtttggacttg
gaaacaatgtcaacaagagatttgcttaatgcattgaatgaagtcattaataatccttca
tataaaaagaatgtgatgtggttatcaagcattcaacgtgatcagcctatgaagcccctt
gaccgagcagtcttctggattgagtttgtcatgcgccacaaaggagctaagcaccttcgg
ccagctgcccacgatctcacctggtaccagtaccactctctggatgtgattgggttcctg
ctagcatgtgtggcaactgctgcgtttgtcatcacaaaatgttacctattttgttaccga
aagtttcttaaaacaggaaagaagaagagggagtag

DBGET integrated database retrieval system