KEGG   Bos taurus (cow): 615334Help
Entry
615334            CDS       T01008                                 

Gene name
DAO
Definition
D-amino-acid oxidase (EC:1.4.3.3)
Orthology
K00273  
D-amino-acid oxidase [EC:1.4.3.3]
Organism
bta  Bos taurus (cow)
Pathway
Glycine, serine and threonine metabolism
Arginine and proline metabolism
D-Arginine and D-ornithine metabolism
Metabolic pathways
Peroxisome
Class
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:bta00260]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:bta00330]
Metabolism; Metabolism of other amino acids; D-Arginine and D-ornithine metabolism [PATH:bta00472]
Metabolism; Biosynthesis of other secondary metabolites; Penicillin and cephalosporin biosynthesis
Cellular Processes; Transport and catabolism; Peroxisome [PATH:bta04146]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
Ensembl: 
Position
17
AA seq 347 aa AA seqDB search
MRVVVIGAGVIGLSTALCIHERYRSVLKSLDVMVYADRFTPLTTTDVAAGLWQPYLSEPS
NPQEAHWNQQTFNYLLSLIGSPNAANMGLAPVSGYNLFREAVPDPYWKDIVLGFRKLTLR
ELDMFPDYSYGWFNTSLILEGRKYLQWLTERLTERGVKFFLWKVESFEEVVREGADVIIN
CTGVWAGALQPDPLLQPGRGQIIKVDAPWLKHFVITHDPERGIYKSPYIIPGLQAITLGG
IFQLGNWSETSNIPDHNTIWEGCCRLEPTLKDAKIIGEWSGFRPVRPQVRLEREQLRFGS
SNTEVIHNYGHGGFGLTIHWGCAQEVAKLFGKILEERNLLRIPPSHL
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgtggtcgtgatcggagcgggcgtcatcgggctgtccaccgccctctgcatccat
gagcgctatcgctcggtcctgaagtcgctggatgtgatggtctatgcagaccgcttcacc
ccactcaccaccaccgacgtggctgccggcctctggcagccctacctctcggagcccagc
aacccacaggaggcgcactggaaccagcagaccttcaactatctcctgagcctcatcggt
tctcccaatgctgcaaacatgggcctggccccggtctcaggctacaacctcttccgtgaa
gctgttccggacccttactggaaggatatagttctgggatttcggaagctgactctcaga
gagctagacatgtttcctgattacagctatggctggttcaacacaagcctgattctggag
gggaggaagtatctgcagtggctgactgaaaggttaactgagagaggagtgaaattcttc
ctgtggaaggtggagtcttttgaggaggtggtaagagaaggcgccgatgtgattatcaac
tgcactggggtgtgggctggggcgctgcaaccagatcccctgctgcagccaggccgaggg
cagatcattaaggtggatgcgccatggttgaaacacttcgttatcacccatgaccctgag
agaggcatctacaagtctccatacatcatcccagggctccaggcaataacccttggcggc
atcttccagctggggaactggagtgagacaagtaatatcccagaccacaacaccatttgg
gaaggctgctgcagactggagcccacactgaaggatgcaaaaattatcggtgaatggtct
ggcttccggccagtacgcccccaggttcgactagaaagagaacagcttcgctttggatcg
tcaaacacagaggtcatccacaactatggccatggaggcttcgggctcaccatccactgg
ggctgtgcccaagaggtggccaagctctttgggaaaattctggaagaaaggaatttgctc
aggataccaccatcccacctctaa

DBGET integrated database retrieval system