KEGG   Bos taurus (cow): 615512Help
Entry
615512            CDS       T01008                                 

Gene name
CCNH
Definition
cyclin H
Orthology
K06634  
cyclin H
Organism
bta  Bos taurus (cow)
Pathway
Basal transcription factors
Nucleotide excision repair
Cell cycle
Module
Holo-TFIIH complex
Brite
KEGG Orthology (KO) [BR:bta00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    615512 (CCNH)
  Replication and repair
   03420 Nucleotide excision repair
    615512 (CCNH)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    615512 (CCNH)
Transcription machinery [BR:bta03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     615512 (CCNH)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
Ensembl: 
UniProt: 
Position
7
AA seq 320 aa AA seqDB search
MYHNSSQKRHWTFASEEQLARLRADANRKFKCKAVANGKVLPNDPVFLEPHEEITLCKYY
EKRLLEFCSVFKPAMPRSVVGTACMYFKRFYLNNSVMEYHPRIIMLTCAFLACKVDEFNV
SSPQFVGNLRESPLGQEKTLEQILEYELLLIQQLNFHLIVHNPYRPFEGFLIDLKTRYPL
LENPEILRKTADDFLNRVALTDAHLLYTPSQIALTAILSSASRAGITMESYLSESLMLKE
NRTSLSQLLDIMKSMRNLVKKYEPPRPEEVAALKQKLERCHSAELALNVVTKKRKGYEDD
DYVSKKSKHEEVCSPKGSFM
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgtaccacaacagtagccagaagaggcactggactttcgccagcgaggagcagctggcg
cggttgcgggccgacgccaaccgcaaattcaaatgcaaagcggtggcgaacgggaaggtt
cttccaaatgaccccgtctttcttgagcctcatgaagaaataacgctctgcaagtattat
gagaaaagattattggaattctgttcggtgtttaagccagcaatgccaagatctgttgtg
ggtacagcttgtatgtatttcaagcgcttttaccttaataattcagtaatggaataccac
ccccggataataatgctcacttgtgcatttttggcttgcaaagtagatgaattcaatgta
tctagtccacagtttgttggaaatctgcgggagagccctcttggacaagagaaaacactc
gaacagattctggaatatgaactgcttcttatacagcaacttaatttccaccttattgtc
cacaatccttatagaccctttgagggctttctcattgatttaaagactcgctatcccctg
ttggagaatccagagattttgaggaaaacagctgatgactttcttaatagagttgcattg
acggatgctcaccttttatacacaccttcccagattgctctgactgccattttatctagt
gcatccagagcaggaattactatggaaagttatttatcagaaagtctgatgctcaaggag
aacagaacttccttgtcccaattactagatataatgaaaagcatgaggaacttggtaaaa
aaatacgaaccacccagacctgaagaagttgctgctctgaaacagaagctggagaggtgt
cactctgctgagcttgcacttaatgtagttacgaagaagagaaaaggttacgaagatgat
gattatgtttcaaagaaatccaaacatgaggaggtatgttctccaaagggtagctttatg
tga

DBGET integrated database retrieval system