KEGG   Bos taurus (cow): 615512Help
Entry
615512            CDS       T01008                                 

Gene name
CCNH
Definition
cyclin H
Orthology
K06634  
cyclin H
Organism
bta  Bos taurus (cow)
Pathway
Basal transcription factors
Nucleotide excision repair
Cell cycle
Module
Holo-TFIIH complex
Class
Genetic Information Processing; Transcription; Basal transcription factors [PATH:bta03022]
Genetic Information Processing; Replication and repair; Nucleotide excision repair [PATH:bta03420]
Cellular Processes; Cell growth and death; Cell cycle [PATH:bta04110]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
Ensembl: 
UniProt: 
Position
7
AA seq 320 aa AA seqDB search
MYHNSSQKRHWTFASEEQLARLRADANRKFKCKAVANGKVLPNDPVFLEPHEEITLCKYY
EKRLLEFCSVFKPAMPRSVVGTACMYFKRFYLNNSVMEYHPRIIMLTCAFLACKVDEFNV
SSPQFVGNLRESPLGQEKTLEQILEYELLLIQQLNFHLIVHNPYRPFEGFLIDLKTRYPL
LENPEILRKTADDFLNRVALTDAHLLYTPSQIALTAILSSASRAGITMESYLSESLMLKE
NRTSLSQLLDIMKSMRNLVKKYEPPRPEEVAALKQKLERCHSAELALNVVTKKRKGYEDD
DYVSKKSKHEEVCSPKGSFM
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgtaccacaacagtagccagaagaggcactggactttcgccagcgaggagcagctggcg
cggttgcgggccgacgccaaccgcaaattcaaatgcaaagcggtggcgaacgggaaggtt
cttccaaatgaccccgtctttcttgagcctcatgaagaaataacgctctgcaagtattat
gagaaaagattattggaattctgttcggtgtttaagccagcaatgccaagatctgttgtg
ggtacagcttgtatgtatttcaagcgcttttaccttaataattcagtaatggaataccac
ccccggataataatgctcacttgtgcatttttggcttgcaaagtagatgaattcaatgta
tctagtccacagtttgttggaaatctgcgggagagccctcttggacaagagaaaacactc
gaacagattctggaatatgaactgcttcttatacagcaacttaatttccaccttattgtc
cacaatccttatagaccctttgagggctttctcattgatttaaagactcgctatcccctg
ttggagaatccagagattttgaggaaaacagctgatgactttcttaatagagttgcattg
acggatgctcaccttttatacacaccttcccagattgctctgactgccattttatctagt
gcatccagagcaggaattactatggaaagttatttatcagaaagtctgatgctcaaggag
aacagaacttccttgtcccaattactagatataatgaaaagcatgaggaacttggtaaaa
aaatacgaaccacccagacctgaagaagttgctgctctgaaacagaagctggagaggtgt
cactctgctgagcttgcacttaatgtagttacgaagaagagaaaaggttacgaagatgat
gattatgtttcaaagaaatccaaacatgaggaggtatgttctccaaagggtagctttatg
tga

DBGET integrated database retrieval system