KEGG   Bos taurus (cow): 615512Help
Entry
615512            CDS       T01008                                 

Gene name
CCNH
Definition
(RefSeq) cyclin H
  KO
K06634  cyclin H
Organism
bta  Bos taurus (cow)
Pathway
bta03022  Basal transcription factors
bta03420  Nucleotide excision repair
bta04110  Cell cycle
Module
bta_M00290  Holo-TFIIH complex
Brite
KEGG Orthology (KO) [BR:bta00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    615512 (CCNH)
  Replication and repair
   03420 Nucleotide excision repair
    615512 (CCNH)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    615512 (CCNH)
Transcription machinery [BR:bta03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     615512 (CCNH)
DNA repair and recombination proteins [BR:bta03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TFIIH complex
     615512 (CCNH)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cyclin_C_2 Cyclin_N 5_3_exonuc_N Helo_like_N
Motif
Other DBs
NCBI-GeneID: 615512
NCBI-ProteinID: NP_001073256
BGD-bta: BT22126
Ensembl: ENSBTAG00000009566
UniProt: Q3ZBL9
Position
7
AA seq 320 aa AA seqDB search
MYHNSSQKRHWTFASEEQLARLRADANRKFKCKAVANGKVLPNDPVFLEPHEEITLCKYY
EKRLLEFCSVFKPAMPRSVVGTACMYFKRFYLNNSVMEYHPRIIMLTCAFLACKVDEFNV
SSPQFVGNLRESPLGQEKTLEQILEYELLLIQQLNFHLIVHNPYRPFEGFLIDLKTRYPL
LENPEILRKTADDFLNRVALTDAHLLYTPSQIALTAILSSASRAGITMESYLSESLMLKE
NRTSLSQLLDIMKSMRNLVKKYEPPRPEEVAALKQKLERCHSAELALNVVTKKRKGYEDD
DYVSKKSKHEEVCSPKGSFM
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgtaccacaacagtagccagaagaggcactggactttcgccagcgaggagcagctggcg
cggttgcgggccgacgccaaccgcaaattcaaatgcaaagcggtggcgaacgggaaggtt
cttccaaatgaccccgtctttcttgagcctcatgaagaaataacgctctgcaagtattat
gagaaaagattattggaattctgttcggtgtttaagccagcaatgccaagatctgttgtg
ggtacagcttgtatgtatttcaagcgcttttaccttaataattcagtaatggaataccac
ccccggataataatgctcacttgtgcatttttggcttgcaaagtagatgaattcaatgta
tctagtccacagtttgttggaaatctgcgggagagccctcttggacaagagaaaacactc
gaacagattctggaatatgaactgcttcttatacagcaacttaatttccaccttattgtc
cacaatccttatagaccctttgagggctttctcattgatttaaagactcgctatcccctg
ttggagaatccagagattttgaggaaaacagctgatgactttcttaatagagttgcattg
acggatgctcaccttttatacacaccttcccagattgctctgactgccattttatctagt
gcatccagagcaggaattactatggaaagttatttatcagaaagtctgatgctcaaggag
aacagaacttccttgtcccaattactagatataatgaaaagcatgaggaacttggtaaaa
aaatacgaaccacccagacctgaagaagttgctgctctgaaacagaagctggagaggtgt
cactctgctgagcttgcacttaatgtagttacgaagaagagaaaaggttacgaagatgat
gattatgtttcaaagaaatccaaacatgaggaggtatgttctccaaagggtagctttatg
tga

DBGET integrated database retrieval system