KEGG   Bos taurus (cow): 615537Help
Entry
615537            CDS       T01008                                 

Gene name
GSTM2
Definition
(RefSeq) glutathione S-transferase M2
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
bta  Bos taurus (cow)
Pathway
bta00480  Glutathione metabolism
bta00980  Metabolism of xenobiotics by cytochrome P450
bta00982  Drug metabolism - cytochrome P450
bta00983  Drug metabolism - other enzymes
bta01524  Platinum drug resistance
bta05200  Pathways in cancer
bta05204  Chemical carcinogenesis
bta05225  Hepatocellular carcinoma
bta05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:bta00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    615537 (GSTM2)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    615537 (GSTM2)
   00982 Drug metabolism - cytochrome P450
    615537 (GSTM2)
   00983 Drug metabolism - other enzymes
    615537 (GSTM2)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    615537 (GSTM2)
   05204 Chemical carcinogenesis
    615537 (GSTM2)
   05225 Hepatocellular carcinoma
    615537 (GSTM2)
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    615537 (GSTM2)
  Drug resistance
   01524 Platinum drug resistance
    615537 (GSTM2)
Enzymes [BR:bta01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     615537 (GSTM2)
Transporters [BR:bta02000]
 Other Transporters
  Pores ion channels [TC:1]
   615537 (GSTM2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N GST_C_3 GST_C GST_C_6 GST_C_2 GST_N_3 GST_N_2
Motif
Other DBs
NCBI-GeneID: 615537
NCBI-ProteinID: XP_005197839
BGD-bta: BT21656
Ensembl: ENSBTAG00000016472
UniProt: F6Q751
Position
3
AA seq 218 aa AA seqDB search
MPMILGYWDIRGLAHAIRLLLEYTDTNYEERQYSVGDAPDYDRSQWLDEKFKLGLDFPNL
PYLIDGTHKLTQSNAILRYIARKHNMCGETEEEMIRVDILENQVMDVRFAMARICYSPDF
EKLKPGFLKEIPEKIKLFSEFLGKRPWFAGDKLSYVDFLVYDVLDMHRIFEPKCLDAFPN
LKDFISRFEGLKKISAYMKSSRFLPGPLFLKLAVWGNK
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgcccatgatcctgggttactgggacatccgcgggctggcccatgccatccgccttctc
ctggagtacacagacacaaactatgaggagaggcagtactcggtaggagatgctcctgac
tatgacagaagccagtggctggatgaaaaattcaagctgggcctggacttccccaatctg
ccctacttaatcgatgggactcacaagctcacccagagcaacgccatccttcggtacatc
gctcgcaagcacaacatgtgtggggagacagaggaggagatgattcgtgtggacattctg
gagaaccaggttatggatgtccgctttgccatggccaggatctgctacagccctgacttt
gagaaactgaagcctggtttcttgaaggagatccctgaaaaaatcaagctgttctcagag
tttctggggaagaggccttggtttgcaggggacaagctcagctatgtggatttcctggtt
tatgacgtccttgacatgcaccgcatatttgagcccaagtgcctggacgcattcccaaac
ctgaaagacttcatttctcgttttgagggcctgaagaagatctctgcctacatgaagtcc
agccgcttcctcccaggccctctgttcctgaagcttgccgtgtggggcaacaagtag

DBGET integrated database retrieval system