KEGG   Bos taurus (cow): 615537Help
Entry
615537            CDS       T01008                                 

Gene name
GSTM2
Definition
(RefSeq) glutathione S-transferase M2
  KO
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
bta  Bos taurus (cow)
Pathway
Glutathione metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Platinum drug resistance
Chemical carcinogenesis
Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:bta00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    615537 (GSTM2)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    615537 (GSTM2)
   00982 Drug metabolism - cytochrome P450
    615537 (GSTM2)
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    615537 (GSTM2)
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    615537 (GSTM2)
  Drug resistance
   01524 Platinum drug resistance
    615537 (GSTM2)
Enzymes [BR:bta01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     615537 (GSTM2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
BGD-bta: 
Ensembl: 
UniProt: 
Position
3
AA seq 218 aa AA seqDB search
MPMILGYWDIRGLAHAIRLLLEYTDTNYEERQYSVGDAPDYDRSQWLDEKFKLGLDFPNL
PYLIDGTHKLTQSNAILRYIARKHNMCGETEEEMIRVDILENQVMDVRFAMARICYSPDF
EKLKPGFLKEIPEKIKLFSEFLGKRPWFAGDKLSYVDFLVYDVLDMHRIFEPKCLDAFPN
LKDFISRFEGLKKISAYMKSSRFLPGPLFLKLAVWGNK
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgcccatgatcctgggttactgggacatccgcgggctggcccatgccatccgccttctc
ctggagtacacagacacaaactatgaggagaggcagtactcggtaggagatgctcctgac
tatgacagaagccagtggctggatgaaaaattcaagctgggcctggacttccccaatctg
ccctacttaatcgatgggactcacaagctcacccagagcaacgccatccttcggtacatc
gctcgcaagcacaacatgtgtggggagacagaggaggagatgattcgtgtggacattctg
gagaaccaggttatggatgtccgctttgccatggccaggatctgctacagccctgacttt
gagaaactgaagcctggtttcttgaaggagatccctgaaaaaatcaagctgttctcagag
tttctggggaagaggccttggtttgcaggggacaagctcagctatgtggatttcctggtt
tatgacgtccttgacatgcaccgcatatttgagcccaagtgcctggacgcattcccaaac
ctgaaagacttcatttctcgttttgagggcctgaagaagatctctgcctacatgaagtcc
agccgcttcctcccaggccctctgttcctgaagcttgccgtgtggggcaacaagtag

DBGET integrated database retrieval system