KEGG   Bos taurus (cow): 615537Help
Entry
615537            CDS       T01008                                 

Gene name
GSTM2
Definition
glutathione S-transferase M2
Orthology
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
bta  Bos taurus (cow)
Pathway
Glutathione metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:bta00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    615537 (GSTM2)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    615537 (GSTM2)
   00982 Drug metabolism - cytochrome P450
    615537 (GSTM2)
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    615537 (GSTM2)
Enzymes [BR:bta01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     615537 (GSTM2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
Ensembl: 
UniProt: 
Position
3
AA seq 181 aa AA seqDB search
MPMILGYWDIRGLAHAIRLLLEYTDTNYEERQYSVGDAPDYDRSQWLDEKFKLGLDFPNL
PYLIDGTHKLTQSNAILRYIARKHNMCGETEEEMIRVDILENQVMDVRFAMARICYSPDF
EKLKPGFLKEIPEKIKLFSEFLGKRPWFAGDKGLKKISAYMKSSRFLPGPLFLKLAVWGN
K
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atgcccatgatcctgggttactgggacatccgcgggctggcccatgccatccgccttctc
ctggagtacacagacacaaactatgaggagaggcagtactcggtaggagatgctcctgac
tatgacagaagccagtggctggatgaaaaattcaagctgggcctggacttccccaatctg
ccctacttaatcgatgggactcacaagctcacccagagcaacgccatccttcggtacatc
gctcgcaagcacaacatgtgtggggagacagaggaggagatgattcgtgtggacattctg
gagaaccaggttatggatgtccgctttgccatggccaggatctgctacagccctgacttt
gagaaactgaagcctggtttcttgaaggagatccctgaaaaaatcaagctgttctcagag
tttctggggaagaggccttggtttgcaggggacaagggcctgaagaagatctctgcctac
atgaagtccagccgcttcctcccaggccctctgttcctgaagcttgccgtgtggggcaac
aagtag

DBGET integrated database retrieval system