KEGG   Bos taurus (cow): 615537Help
Entry
615537            CDS       T01008                                 

Gene name
GSTM2
Definition
glutathione S-transferase M2
Orthology
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
bta  Bos taurus (cow)
Pathway
Glutathione metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Chemical carcinogenesis
Class
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:bta00480]
Metabolism; Xenobiotics biodegradation and metabolism; Metabolism of xenobiotics by cytochrome P450 [PATH:bta00980]
Metabolism; Xenobiotics biodegradation and metabolism; Drug metabolism - cytochrome P450 [PATH:bta00982]
Human Diseases; Cancers; Chemical carcinogenesis [PATH:bta05204]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
Ensembl: 
UniProt: 
Position
3
AA seq 181 aa AA seqDB search
MPMILGYWDIRGLAHAIRLLLEYTDTNYEERQYSVGDAPDYDRSQWLDEKFKLGLDFPNL
PYLIDGTHKLTQSNAILRYIARKHNMCGETEEEMIRVDILENQVMDVRFAMARICYSPDF
EKLKPGFLKEIPEKIKLFSEFLGKRPWFAGDKGLKKISAYMKSSRFLPGPLFLKLAVWGN
K
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atgcccatgatcctgggttactgggacatccgcgggctggcccatgccatccgccttctc
ctggagtacacagacacaaactatgaggagaggcagtactcggtaggagatgctcctgac
tatgacagaagccagtggctggatgaaaaattcaagctgggcctggacttccccaatctg
ccctacttaatcgatgggactcacaagctcacccagagcaacgccatccttcggtacatc
gctcgcaagcacaacatgtgtggggagacagaggaggagatgattcgtgtggacattctg
gagaaccaggttatggatgtccgctttgccatggccaggatctgctacagccctgacttt
gagaaactgaagcctggtttcttgaaggagatccctgaaaaaatcaagctgttctcagag
tttctggggaagaggccttggtttgcaggggacaagggcctgaagaagatctctgcctac
atgaagtccagccgcttcctcccaggccctctgttcctgaagcttgccgtgtggggcaac
aagtag

DBGET integrated database retrieval system