KEGG   Bos taurus (cow): 615581Help
Entry
615581            CDS       T01008                                 

Gene name
NXF3
Definition
nuclear RNA export factor 3
Orthology
K14284  
nuclear RNA export factor 1/2
Organism
bta  Bos taurus (cow)
Pathway
Ribosome biogenesis in eukaryotes
RNA transport
mRNA surveillance pathway
Influenza A
Herpes simplex infection
Class
Genetic Information Processing; Translation; RNA transport [PATH:bta03013]
Genetic Information Processing; Translation; mRNA surveillance pathway [PATH:bta03015]
Genetic Information Processing; Translation; Ribosome biogenesis in eukaryotes [PATH:bta03008]
Human Diseases; Infectious diseases; Influenza A [PATH:bta05164]
Human Diseases; Infectious diseases; Herpes simplex infection [PATH:bta05168]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
Ensembl: 
UniProt: 
Position
X
AA seq 529 aa AA seqDB search
MEHTDKVKSLQRRAQSSGIYRRQYACWSEPVTSQQQQDRDSKESDAHMVIQGRYAPYAIP
SHHWRSSFQRKDQMHVNMESDQKPPERTMKTNRQDETLESWFKIIIPFGIKYDEKWLMNL
IQKKCSVPFTAVEFHYEKMQAQFFVENANVACALKNVSGKIFNEDNEKISIFVEPCDAPQ
SVQKTLTCEKLEKIKFPGDLITRGIGMTWNLRNSMAASLHVYPGIRPMLSSLYLSNKKLY
LVHGLSTIMEISSTMENLNLSNTEVKIAGEMDTGHQLEPEGMCADRSAVCTTFRDESTNM
STLLELFPRLLSLDGQETLSGSKCAVEAPKCLPMYKGSFSGSDQVNSQILQFLQHYYLIH
DYGDRQGLLGFYHEEACFFLTIPFHSKDSGLSSMCAYFLDNRNMKTLKDPNPRVQMMKHT
KHDIVRALCALPKTQHDFSSFEVDMCFHTETMFCFSVSGVFKEVEGISQGCVCAFTRTFT
TTPTSSSSFCIVNDELFVREASPSEAQRLHSPSLCQPPSWSSSPPSSRK
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atggagcacactgataaagtgaagtctttacaaagaagagcacaaagctcgggtatttac
cgaaggcaatacgcctgttggtctgaaccggtcacttcccagcagcagcaagacagagat
tcaaaagaaagtgatgctcatatggtcatccaaggaagatatgctccctatgccattcca
tcccatcactggagaagcagttttcagagaaaagaccaaatgcatgttaacatggagtca
gaccaaaagcctccggagagaacaatgaaaacaaatagacaggatgagaccttggagagc
tggttcaagattattattccctttggtataaaatatgatgagaagtggctgatgaatttg
attcagaagaagtgcagtgtcccctttactgcagtcgaatttcactatgagaaaatgcag
gcccagttctttgtagagaatgccaacgttgcctgtgcattgaagaatgtcagcggcaag
attttcaatgaggataatgaaaagatatctatctttgttgagccctgtgatgcaccccag
tctgtgcagaagacactgacatgtgaaaagttggagaagataaagtttcctggagacttg
ataacacgtggtattggaatgacatggaaccttagaaatagcatggctgcttccctgcac
gtctatccagggatcaggcccatgctttcatctttgtacttgagcaacaagaaactgtac
ttggtgcatggcctgtccaccattatggagatttcttccaccatggagaacttgaatctc
tccaacactgaggtgaagattgcaggggagatggacacgggtcatcagctggaaccagaa
gggatgtgtgcagacagaagtgctgtgtgcaccaccttccgtgatgagtcaaccaacatg
agcaccctcctggagttgttccccaggttactaagcttggatggccaggagacactctca
ggttctaaatgtgctgtggaagcccccaagtgcttaccaatgtacaagggaagtttctct
ggatctgatcaggtgaacagtcaaatcctgcaattcctgcagcactattacttgatccat
gactatggagatcgccagggactgctgggcttttatcatgaggaggcctgcttcttcctg
accattccattccactccaaggactcaggcttaagcagtatgtgtgcgtacttcttggac
aacaggaatatgaagacactcaaggaccccaacccgcgtgtccagatgatgaaacacaca
aaacatgacattgtgcgtgccctctgtgcattacccaaaactcagcatgacttcagctcc
tttgaggtggacatgtgtttccacacggaaacgatgttctgcttctctgtcagtggggtg
ttcaaggaagtggaaggaatttctcagggctgtgtctgtgccttcacccggaccttcacc
actactcccaccagctcttccagtttttgtatagtgaatgatgagctgtttgtaagggaa
gccagccccagtgaagctcagcgtctgcattctccatccctgtgtcagccaccttcatgg
tcatcctctcccccgagtagcagaaaatga

DBGET integrated database retrieval system