KEGG   Bos taurus (cow): 615581Help
Entry
615581            CDS       T01008                                 

Gene name
NXF3
Definition
(RefSeq) nuclear RNA export factor 3
  KO
K14284  
nuclear RNA export factor
Organism
bta  Bos taurus (cow)
Pathway
Ribosome biogenesis in eukaryotes
RNA transport
mRNA surveillance pathway
Influenza A
Herpes simplex infection
Brite
KEGG Orthology (KO) [BR:bta00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    615581 (NXF3)
   03015 mRNA surveillance pathway
    615581 (NXF3)
   03008 Ribosome biogenesis in eukaryotes
    615581 (NXF3)
 Human Diseases
  Infectious diseases
   05164 Influenza A
    615581 (NXF3)
   05168 Herpes simplex infection
    615581 (NXF3)
Messenger RNA biogenesis [BR:bta03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     615581 (NXF3)
   mRNA cycle factors
    Stress granule specific factors
     615581 (NXF3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
Ensembl: 
UniProt: 
Position
X
AA seq 529 aa AA seqDB search
MEHTDKVKSLQRRAQSSGIYRRQYACWSEPVTSQQQQDRDSKESDAHMVIQGRYAPYAIP
SHHWRSSFQRKDQMHVNMESDQKPPERTMKTNRQDETLESWFKIIIPFGIKYDEKWLMNL
IQKKCSVPFTAVEFHYEKMQAQFFVENANVACALKNVSGKIFNEDNEKISIFVEPCDAPQ
SVQKTLTCEKLEKIKFPGDLITRGIGMTWNLRNSMAASLHVYPGIRPMLSSLYLSNKKLY
LVHGLSTIMEISSTMENLNLSNTEVKIAGEMDTGHQLEPEGMCADRSAVCTTFRDESTNM
STLLELFPRLLSLDGQETLSGSKCAVEAPKCLPMYKGSFSGSDQVNSQILQFLQHYYLIH
DYGDRQGLLGFYHEEACFFLTIPFHSKDSGLSSMCAYFLDNRNMKTLKDPNPRVQMMKHT
KHDIVRALCALPKTQHDFSSFEVDMCFHTETMFCFSVSGVFKEVEGISQGCVCAFTRTFT
TTPTSSSSFCIVNDELFVREASPSEAQRLHSPSLCQPPSWSSSPPSSRK
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atggagcacactgataaagtgaagtctttacaaagaagagcacaaagctcgggtatttac
cgaaggcaatacgcctgttggtctgaaccggtcacttcccagcagcagcaagacagagat
tcaaaagaaagtgatgctcatatggtcatccaaggaagatatgctccctatgccattcca
tcccatcactggagaagcagttttcagagaaaagaccaaatgcatgttaacatggagtca
gaccaaaagcctccggagagaacaatgaaaacaaatagacaggatgagaccttggagagc
tggttcaagattattattccctttggtataaaatatgatgagaagtggctgatgaatttg
attcagaagaagtgcagtgtcccctttactgcagtcgaatttcactatgagaaaatgcag
gcccagttctttgtagagaatgccaacgttgcctgtgcattgaagaatgtcagcggcaag
attttcaatgaggataatgaaaagatatctatctttgttgagccctgtgatgcaccccag
tctgtgcagaagacactgacatgtgaaaagttggagaagataaagtttcctggagacttg
ataacacgtggtattggaatgacatggaaccttagaaatagcatggctgcttccctgcac
gtctatccagggatcaggcccatgctttcatctttgtacttgagcaacaagaaactgtac
ttggtgcatggcctgtccaccattatggagatttcttccaccatggagaacttgaatctc
tccaacactgaggtgaagattgcaggggagatggacacgggtcatcagctggaaccagaa
gggatgtgtgcagacagaagtgctgtgtgcaccaccttccgtgatgagtcaaccaacatg
agcaccctcctggagttgttccccaggttactaagcttggatggccaggagacactctca
ggttctaaatgtgctgtggaagcccccaagtgcttaccaatgtacaagggaagtttctct
ggatctgatcaggtgaacagtcaaatcctgcaattcctgcagcactattacttgatccat
gactatggagatcgccagggactgctgggcttttatcatgaggaggcctgcttcttcctg
accattccattccactccaaggactcaggcttaagcagtatgtgtgcgtacttcttggac
aacaggaatatgaagacactcaaggaccccaacccgcgtgtccagatgatgaaacacaca
aaacatgacattgtgcgtgccctctgtgcattacccaaaactcagcatgacttcagctcc
tttgaggtggacatgtgtttccacacggaaacgatgttctgcttctctgtcagtggggtg
ttcaaggaagtggaaggaatttctcagggctgtgtctgtgccttcacccggaccttcacc
actactcccaccagctcttccagtttttgtatagtgaatgatgagctgtttgtaagggaa
gccagccccagtgaagctcagcgtctgcattctccatccctgtgtcagccaccttcatgg
tcatcctctcccccgagtagcagaaaatga

DBGET integrated database retrieval system