KEGG   Bos taurus (cow): 615581Help
Entry
615581            CDS       T01008                                 

Gene name
NXF3
Definition
nuclear RNA export factor 3
Orthology
K14284  
nuclear RNA export factor
Organism
bta  Bos taurus (cow)
Pathway
Ribosome biogenesis in eukaryotes
RNA transport
mRNA surveillance pathway
Influenza A
Herpes simplex infection
Brite
KEGG Orthology (KO) [BR:bta00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    615581 (NXF3)
   03015 mRNA surveillance pathway
    615581 (NXF3)
   03008 Ribosome biogenesis in eukaryotes
    615581 (NXF3)
 Human Diseases
  Infectious diseases
   05164 Influenza A
    615581 (NXF3)
   05168 Herpes simplex infection
    615581 (NXF3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
Ensembl: 
UniProt: 
Position
X
AA seq 529 aa AA seqDB search
MEHTDKVKSLQRRAQSSGIYRRQYACWSEPVTSQQQQDRDSKESDAHMVIQGRYAPYAIP
SHHWRSSFQRKDQMHVNMESDQKPPERTMKTNRQDETLESWFKIIIPFGIKYDEKWLMNL
IQKKCSVPFTAVEFHYEKMQAQFFVENANVACALKNVSGKIFNEDNEKISIFVEPCDAPQ
SVQKTLTCEKLEKIKFPGDLITRGIGMTWNLRNSMAASLHVYPGIRPMLSSLYLSNKKLY
LVHGLSTIMEISSTMENLNLSNTEVKIAGEMDTGHQLEPEGMCADRSAVCTTFRDESTNM
STLLELFPRLLSLDGQETLSGSKCAVEAPKCLPMYKGSFSGSDQVNSQILQFLQHYYLIH
DYGDRQGLLGFYHEEACFFLTIPFHSKDSGLSSMCAYFLDNRNMKTLKDPNPRVQMMKHT
KHDIVRALCALPKTQHDFSSFEVDMCFHTETMFCFSVSGVFKEVEGISQGCVCAFTRTFT
TTPTSSSSFCIVNDELFVREASPSEAQRLHSPSLCQPPSWSSSPPSSRK
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atggagcacactgataaagtgaagtctttacaaagaagagcacaaagctcgggtatttac
cgaaggcaatacgcctgttggtctgaaccggtcacttcccagcagcagcaagacagagat
tcaaaagaaagtgatgctcatatggtcatccaaggaagatatgctccctatgccattcca
tcccatcactggagaagcagttttcagagaaaagaccaaatgcatgttaacatggagtca
gaccaaaagcctccggagagaacaatgaaaacaaatagacaggatgagaccttggagagc
tggttcaagattattattccctttggtataaaatatgatgagaagtggctgatgaatttg
attcagaagaagtgcagtgtcccctttactgcagtcgaatttcactatgagaaaatgcag
gcccagttctttgtagagaatgccaacgttgcctgtgcattgaagaatgtcagcggcaag
attttcaatgaggataatgaaaagatatctatctttgttgagccctgtgatgcaccccag
tctgtgcagaagacactgacatgtgaaaagttggagaagataaagtttcctggagacttg
ataacacgtggtattggaatgacatggaaccttagaaatagcatggctgcttccctgcac
gtctatccagggatcaggcccatgctttcatctttgtacttgagcaacaagaaactgtac
ttggtgcatggcctgtccaccattatggagatttcttccaccatggagaacttgaatctc
tccaacactgaggtgaagattgcaggggagatggacacgggtcatcagctggaaccagaa
gggatgtgtgcagacagaagtgctgtgtgcaccaccttccgtgatgagtcaaccaacatg
agcaccctcctggagttgttccccaggttactaagcttggatggccaggagacactctca
ggttctaaatgtgctgtggaagcccccaagtgcttaccaatgtacaagggaagtttctct
ggatctgatcaggtgaacagtcaaatcctgcaattcctgcagcactattacttgatccat
gactatggagatcgccagggactgctgggcttttatcatgaggaggcctgcttcttcctg
accattccattccactccaaggactcaggcttaagcagtatgtgtgcgtacttcttggac
aacaggaatatgaagacactcaaggaccccaacccgcgtgtccagatgatgaaacacaca
aaacatgacattgtgcgtgccctctgtgcattacccaaaactcagcatgacttcagctcc
tttgaggtggacatgtgtttccacacggaaacgatgttctgcttctctgtcagtggggtg
ttcaaggaagtggaaggaatttctcagggctgtgtctgtgccttcacccggaccttcacc
actactcccaccagctcttccagtttttgtatagtgaatgatgagctgtttgtaagggaa
gccagccccagtgaagctcagcgtctgcattctccatccctgtgtcagccaccttcatgg
tcatcctctcccccgagtagcagaaaatga

DBGET integrated database retrieval system