KEGG   Bos taurus (cow): 615764Help
Entry
615764            CDS       T01008                                 

Gene name
ADI1, Fe-ARD, MTCBP-1, Ni-ARD
Definition
(RefSeq) acireductone dioxygenase 1
  KO
K08967  1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
bta  Bos taurus (cow)
Pathway
bta00270  Cysteine and methionine metabolism
bta01100  Metabolic pathways
Module
bta_M00034  Methionine salvage pathway
Brite
KEGG Orthology (KO) [BR:bta00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    615764 (ADI1)
Enzymes [BR:bta01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.53  acireductone dioxygenase (Ni2+-requiring)
     615764 (ADI1)
    1.13.11.54  acireductone dioxygenase [iron(II)-requiring]
     615764 (ADI1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ARD Cupin_2 AraC_binding Cupin_8 Cupin_1 Cupin_3
Motif
Other DBs
NCBI-GeneID: 615764
NCBI-ProteinID: NP_001030545
BGD-bta: BT17053
Ensembl: ENSBTAG00000005403
UniProt: Q3ZBL1
Position
8
AA seq 179 aa AA seqDB search
MVEAWYIDDAADDPRLPHRAEPARPVGLEQLRRLGVLYWKLDADKYENDPELEKIRKERN
YSWVDIITISKDKLPNYEEKIKMFFEEHLHLDEEIRYILDGSGYFDVRDQEDRWIRISME
KGDMITLPAGIYHRFTLDEKNYVKAMRLFVGDPVWTPYNRPSDHLEARTQYLEFLAQSA
NT seq 540 nt NT seq  +upstreamnt  +downstreamnt
atggtggaggcctggtacatagacgatgcggccgacgacccgcggctgccgcaccgcgcc
gagcccgcgcgccctgtcggcctggagcagctgcgccggctcggggtcctttactggaag
ctggatgcagacaaatacgagaacgatccagaattagagaagatccgcaaagagagaaac
tactcctgggtggacatcataaccataagcaaagacaaactaccgaattacgaggaaaag
atcaagatgttctttgaggagcacttacacctggacgaggagatccgctacatcctggac
ggcagcgggtactttgacgtgcgggaccaggaggaccgctggatccggatctccatggag
aagggggacatgatcaccctgcccgccggcatctaccaccgcttcacgctggacgagaag
aactacgtgaaggccatgcggctgttcgtgggagaccccgtgtggacgccatacaaccgg
ccgtcggaccacctcgaggcccggacgcaatacctggagttcctggcgcagtcggcctag

DBGET integrated database retrieval system