KEGG   Bos taurus (cow): 616431Help
Entry
616431            CDS       T01008                                 

Definition
H2B histone family, member W, testis-specific-like
Orthology
K11252  
histone H2B
Organism
bta  Bos taurus (cow)
Pathway
Alcoholism
Viral carcinogenesis
Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:bta00001]
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    616431
  Immune diseases
   05322 Systemic lupus erythematosus
    616431
  Substance dependence
   05034 Alcoholism
    616431
Exosome [BR:bta04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   616431
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
Position
X
AA seq 166 aa AA seqDB search
MENGGSVVSQPSPDGYEEDVITKETGTSETEPSETEMAKAETSKPEPCDAEPKKAKQKTA
NGRRRRRRHRHNDNFSRFATYFPRVLRQIHKGMSLSRDSVNILDSFVKDMFERIAEEAGR
LARNNKRRTITHEDIEAAVRLLLPGDLCKYAINAATKSLIGYHTCR
NT seq 501 nt NT seq  +upstreamnt  +downstreamnt
atggagaatggcggctctgtcgtgtcccaaccatcccctgacggctatgaggaagacgtg
atcaccaaagaaactggcacctccgaaactgagccctctgaaacggagatggcgaaagcg
gagacctccaaaccagagccgtgtgatgcggaaccaaaaaaggcaaagcagaagacagct
aatggccgccgtcgccgtcgccggcaccgccataacgacaatttctcacgttttgctacc
tatttccctagggtgctgaggcaaatacataaaggcatgagtctttcccgcgactccgtg
aacatcctggattcgtttgtgaaagatatgtttgagcggatagccgaagaggccgggcgc
ctggcccgcaacaacaagcgccgcaccatcacgcacgaagacatcgaggcagctgtgcgt
cttctgttgcctggggacctctgcaagtatgccataaacgcggccaccaagtcgctcatc
ggataccacacctgcagatga

DBGET integrated database retrieval system