KEGG   Bos taurus (cow): 616431Help
Entry
616431            CDS       T01008                                 

Definition
(RefSeq) late histone H2B.L4
  KO
K11252  histone H2B
Organism
bta  Bos taurus (cow)
Pathway
bta05034  Alcoholism
bta05203  Viral carcinogenesis
bta05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:bta00001]
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    616431
  Immune diseases
   05322 Systemic lupus erythematosus
    616431
  Substance dependence
   05034 Alcoholism
    616431
Chromosome and associated proteins [BR:bta03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histones
    616431
Exosome [BR:bta04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   616431
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Histone CBFD_NFYB_HMF TAF CENP-T_C TFIID-18kDa Nop53 TFIID_20kDa DUF1931 Flagellar_rod
Motif
Other DBs
NCBI-GeneID: 616431
NCBI-ProteinID: XP_015317060
BGD-bta: BT22452
Position
X
AA seq 166 aa AA seqDB search
MENGGSVVSQPSPDGYEEDVITKETGTSETEPSETEMAKAETSKPEPCDAEPKKAKQKTA
NGRRRRRRHRHNDNFSRFATYFPRVLRQIHKGMSLSRDSVNILDSFVKDMFERIAEEAGR
LARNNKRRTITHEDIEAAVRLLLPGDLCKYAINAATKSLIGYHTCR
NT seq 501 nt NT seq  +upstreamnt  +downstreamnt
atggagaatggcggctctgtcgtgtcccaaccatcccctgacggctatgaggaagacgtg
atcaccaaagaaactggcacctccgaaactgagccctctgaaacggagatggcgaaagcg
gagacctccaaaccagagccgtgtgatgcggaaccaaaaaaggcaaagcagaagacagct
aatggccgccgtcgccgtcgccggcaccgccataacgacaatttctcacgttttgctacc
tatttccctagggtgctgaggcaaatacataaaggcatgagtctttcccgcgactccgtg
aacatcctggattcgtttgtgaaagatatgtttgagcggatagccgaagaggccgggcgc
ctggcccgcaacaacaagcgccgcaccatcacgcacgaagacatcgaggcagctgtgcgt
cttctgttgcctggggacctctgcaagtatgccataaacgcggccaccaagtcgctcatc
ggataccacacctgcagatga

DBGET integrated database retrieval system