KEGG   Bos taurus (cow): 616576Help
Entry
616576            CDS       T01008                                 

Gene name
GCK
Definition
(RefSeq) glucokinase
  KO
K12407  glucokinase [EC:2.7.1.2]
Organism
bta  Bos taurus (cow)
Pathway
bta00010  Glycolysis / Gluconeogenesis
bta00052  Galactose metabolism
bta00500  Starch and sucrose metabolism
bta00520  Amino sugar and nucleotide sugar metabolism
bta00524  Neomycin, kanamycin and gentamicin biosynthesis
bta01100  Metabolic pathways
bta01200  Carbon metabolism
bta04910  Insulin signaling pathway
bta04911  Insulin secretion
bta04917  Prolactin signaling pathway
bta04922  Glucagon signaling pathway
bta04930  Type II diabetes mellitus
bta04950  Maturity onset diabetes of the young
bta05230  Central carbon metabolism in cancer
Module
bta_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
bta_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:bta00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    616576 (GCK)
   00052 Galactose metabolism
    616576 (GCK)
   00500 Starch and sucrose metabolism
    616576 (GCK)
   00520 Amino sugar and nucleotide sugar metabolism
    616576 (GCK)
  Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    616576 (GCK)
 Organismal Systems
  Endocrine system
   04911 Insulin secretion
    616576 (GCK)
   04910 Insulin signaling pathway
    616576 (GCK)
   04922 Glucagon signaling pathway
    616576 (GCK)
   04917 Prolactin signaling pathway
    616576 (GCK)
 Human Diseases
  Cancers
   05230 Central carbon metabolism in cancer
    616576 (GCK)
  Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    616576 (GCK)
   04950 Maturity onset diabetes of the young
    616576 (GCK)
Enzymes [BR:bta01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     616576 (GCK)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1
Motif
Other DBs
NCBI-GeneID: 616576
NCBI-ProteinID: NP_001095772
BGD-bta: BT11156
Ensembl: ENSBTAG00000032288
UniProt: A6QR34
Position
4
AA seq 465 aa AA seqDB search
MLDDRARMEISKKEKAEQILAEFQLQEEDLKKVMRRMQKEMDRGLRLETHKEASVKMLPT
YVRSTPEGSEVGDFLSLDLGGTNFRVMLVKVGEGEAGQWSVKTTHQMYSIPEDAMTGTAE
MLFDYISECISDFLDKHQMKHKKLPLGFTFSFPVRHEDIDKGILLNWTKGFKASGAEGNN
IVGLLRDAIKRRGDFEMDVVAMVNDTVATMISCYYEDRRCEVGMIVGTGCNACYMEEMQN
VELVEGDEGRMCVNTEWGAFGDSGELDEFLLEYDRVVDENSLNPGQQLYEKLIGGKYMGE
LVRLVLLKLVDENLLFHGEASEQLRTRGAFETRFVSQVESDSGDRKQIYNILSTLGLRPS
ATDCDIVRRACESVSTRAAHMCAAGLAGVINRMRESRSEDVMRITVGVDGSVYKLHPSFK
ERFHAIVRRLTPSCEITFIESEEGSGRGAALISAVACKKACMLGQ
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgctggatgacagagccaggatggagatctccaagaaggaaaaggcggaacagatcctg
gcagagttccagctgcaggaggaggacttgaagaaggtgatgaggcggatgcagaaggag
atggaccgaggcctgaggctggagacccacaaggaggccagtgtgaagatgctgcccacc
tatgtgcgctccaccccagagggctcagaagttggggacttcctctccctggacctgggt
ggcaccaacttccgggtgatgctggtgaaggtgggagaaggcgaggcgggacagtggagt
gtgaagaccacgcaccagatgtactccatccccgaggatgccatgacgggtactgctgag
atgctctttgactacatctctgagtgcatctctgacttcctggataagcatcagatgaag
cataagaagctgcccttgggcttcaccttctcctttcccgtgaggcatgaagacattgac
aagggcatccttctcaactggaccaagggcttcaaggcctcgggagcagaaggcaacaac
attgtggggctcctgcgagatgccatcaagcggagaggtgactttgagatggacgtggtg
gccatggtgaatgacactgtggccacgatgatctcctgctactatgaagaccgccggtgt
gaggttggcatgattgtgggcacgggctgcaacgcttgctacatggaggagatgcagaac
gtggagctggtggaaggggacgagggccgcatgtgtgtcaacaccgagtggggcgccttc
ggggactcaggcgagctggacgagttcctgctggagtacgaccgcgtggtggatgagaac
tccctgaaccctggccagcagctgtacgagaaactcatcggtggcaagtacatgggcgag
ctggtgcggcttgtgctgctgaagcttgtggacgagaatctgctcttccacggagaggcc
tcggagcagctgcgcacgcgcggcgccttcgagacacgcttcgtgtctcaggtggagagc
gattccggtgaccgcaagcagatctacaatatcctgagcactctagggctgcgaccctcg
gccactgactgtgacatcgtgcgccgagcctgcgagagcgtgtccacgcgcgccgcgcac
atgtgcgccgcgggactggcgggcgtcatcaaccggatgcgcgaaagccgcagcgaggac
gtgatgcgcatcaccgtgggcgtggacggctccgtgtacaagctgcaccctagcttcaag
gagcggttccacgccatcgtgcgcaggctgacgcccagctgtgaaatcaccttcattgag
tcggaggagggcagcggccggggcgcggccttgatctccgcggtggcctgtaagaaggcc
tgcatgctgggccagtaa

DBGET integrated database retrieval system