KEGG   Bos taurus (cow): 616676Help
Entry
616676            CDS       T01008                                 

Gene name
GALM
Definition
(RefSeq) galactose mutarotase
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
bta  Bos taurus (cow)
Pathway
bta00010  Glycolysis / Gluconeogenesis
bta00052  Galactose metabolism
bta01100  Metabolic pathways
Module
bta_M00632  Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:bta00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    616676 (GALM)
   00052 Galactose metabolism
    616676 (GALM)
Enzymes [BR:bta01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     616676 (GALM)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-GeneID: 616676
NCBI-ProteinID: NP_001029967
BGD-bta: BT22976
Ensembl: ENSBTAG00000021102
UniProt: Q5EA79
Position
11
AA seq 342 aa AA seqDB search
MVSVTRAVFGDLPLGAGTVEKFQLQSDQLRVDIISWGCTITALEVKDRQGRASDVVLGFD
ELEGYLQKQPYFGAVVGRVANRIAKGTFTLDGKEYKLAINNGPNSLHGGVKGFDKVLWTP
RVLSNGVEFSRVSPDGEEGYPGELKVWVMYTLDGGELVVNYRAQASQTTPVNLTNHSYFN
LAGQGSPNIYDHEVTIEADAFLPVDEVLIPTGEIASVQGTAFDLRKPVELGKHLQEFHVN
GFDHNFCLKGSKEKRFCARVHHAGSGRVLEVYTTQPGVQFYTGNFLDGTLKGKSGAGYPK
HSGFCLETQSWPDAVNQPHFPPVLLKPGEEYDHTTWFKFSVA
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atggtttcggtgaccagagccgtgtttggagacctgcccctgggagcagggacagtggag
aagttccagctgcagtcagaccagctgagagtggacatcatctcctggggctgcaccatc
acagccctggaggtcaaagacaggcagggcagagcctcagatgtggtgctcggctttgac
gagttggaagggtacctccaaaagcagccctactttggagctgtggttggcagggtggcc
aaccgaattgccaaaggaacgttcacgttggatgggaaggagtataaactagccattaac
aacgggcccaacagcctgcatggaggagtcaaagggtttgacaaggtcctctggacccct
cgggtgctgtcaaatggtgtcgagttctcacgggtcagtccagacggtgaggaaggctac
cctggagagttaaaagtctgggtgatgtacacactggatggcggtgagcttgtggtcaac
tatcgagcacaggccagtcagaccaccccagtcaatctgaccaatcattcttacttcaac
ctggcaggccagggttccccaaatatatatgaccatgaagtcactatagaagctgatgct
tttttgcctgtggatgaagtcctgattcctacaggagaaattgcttcagtgcaaggaacg
gcatttgacctgaggaagccagtggagcttggaaaacacctgcaggagttccacgtgaat
ggctttgaccacaatttctgtctgaagggatctaaagaaaagcgtttctgtgcacgggtc
catcatgctggaagcgggcgggtactggaagtgtacaccacccaacctggggtccagttt
tacacgggcaacttcctggatggcacgctgaagggcaagagtggagcaggctaccccaag
cactccggattctgccttgagactcagagctggcctgatgcagtcaatcagcctcacttt
ccgcctgtgttgctgaagcctggtgaggagtatgaccacaccacttggttcaagttttct
gtggcctaa

DBGET integrated database retrieval system