KEGG   Bos taurus (cow): 616676Help
Entry
616676            CDS       T01008                                 

Gene name
GALM
Definition
galactose mutarotase (aldose 1-epimerase) (EC:5.1.3.3)
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
bta  Bos taurus (cow)
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Module
Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:bta00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    616676 (GALM)
   00052 Galactose metabolism
    616676 (GALM)
Enzymes [BR:bta01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     616676 (GALM)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
Ensembl: 
UniProt: 
Position
11
AA seq 342 aa AA seqDB search
MVSVTRAVFGDLPLGAGTVEKFQLQSDQLRVDIISWGCTITALEVKDRQGRASDVVLGFD
ELEGYLQKQPYFGAVVGRVANRIAKGTFTLDGKEYKLAINNGPNSLHGGVKGFDKVLWTP
RVLSNGVEFSRVSPDGEEGYPGELKVWVMYTLDGGELVVNYRAQASQTTPVNLTNHSYFN
LAGQGSPNIYDHEVTIEADAFLPVDEVLIPTGEIASVQGTAFDLRKPVELGKHLQEFHVN
GFDHNFCLKGSKEKRFCARVHHAGSGRVLEVYTTQPGVQFYTGNFLDGTLKGKSGAGYPK
HSGFCLETQSWPDAVNQPHFPPVLLKPGEEYDHTTWFKFSVA
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atggtttcggtgaccagagccgtgtttggagacctgcccctgggagcagggacagtggag
aagttccagctgcagtcagaccagctgagagtggacatcatctcctggggctgcaccatc
acagccctggaggtcaaagacaggcagggcagagcctcagatgtggtgctcggctttgac
gagttggaagggtacctccaaaagcagccctactttggagctgtggttggcagggtggcc
aaccgaattgccaaaggaacgttcacgttggatgggaaggagtataaactagccattaac
aacgggcccaacagcctgcatggaggagtcaaagggtttgacaaggtcctctggacccct
cgggtgctgtcaaatggtgtcgagttctcacgggtcagtccagacggtgaggaaggctac
cctggagagttaaaagtctgggtgatgtacacactggatggcggtgagcttgtggtcaac
tatcgagcacaggccagtcagaccaccccagtcaatctgaccaatcattcttacttcaac
ctggcaggccagggttccccaaatatatatgaccatgaagtcactatagaagctgatgct
tttttgcctgtggatgaagtcctgattcctacaggagaaattgcttcagtgcaaggaacg
gcatttgacctgaggaagccagtggagcttggaaaacacctgcaggagttccacgtgaat
ggctttgaccacaatttctgtctgaagggatctaaagaaaagcgtttctgtgcacgggtc
catcatgctggaagcgggcgggtactggaagtgtacaccacccaacctggggtccagttt
tacacgggcaacttcctggatggcacgctgaagggcaagagtggagcaggctaccccaag
cactccggattctgccttgagactcagagctggcctgatgcagtcaatcagcctcacttt
ccgcctgtgttgctgaagcctggtgaggagtatgaccacaccacttggttcaagttttct
gtggcctaa

DBGET integrated database retrieval system