KEGG   Bos taurus (cow): 616895Help
Entry
616895            CDS       T01008                                 

Gene name
RARB
Definition
(RefSeq) retinoic acid receptor, beta
  KO
K08528  
retinoic acid receptor beta
Organism
bta  Bos taurus (cow)
Pathway
Pathways in cancer
Small cell lung cancer
Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:bta00001]
 Human Diseases
  Cancers
   05200 Pathways in cancer
    616895 (RARB)
   05222 Small cell lung cancer
    616895 (RARB)
   05223 Non-small cell lung cancer
    616895 (RARB)
Transcription factors [BR:bta03000]
 Eukaryotic Type
  Zinc finger
   Cys4 thyroid hormone-like
    616895 (RARB)
Nuclear receptors [BR:bta03310]
 1. Thyroid hormone like
  1B. Retinoic acid receptor (RAR)
   616895 (RARB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
Position
27
AA seq 252 aa AA seqDB search
TGAPLSAGRRLFTGDAVLCRPPSPAPHRAPRGGTARPLVTPLCLSALSSAAVRNDRNKKK
KEPSKQECTESYEMTAELDDLTEKIRKAHQETFPSLCQLGKYTTNSSADHRVRLDLGLWD
KFSELATKCIIKIVEFAKRLPGFTGLTIADQITLLKAACLDILILRICTRYTPEQDTMTF
SDGLTLNRTQMHNAGFGPLTDLVFTFAGQLLPLEMDDAETGLLSAICLICGDRQDLEEPT
KVDKLQEPLLEA
NT seq 760 nt NT seq  +upstreamnt  +downstreamnt
gaaccggcgcgccgctgtccgccggccgccgcctgtttaccggggacgctgtgctgtgcc
gaccgccttccccggccccacaccgggcaccacgcggcggcacagcccggcctctggtga
ccccgctctgtctgtctgctctctcgtccgcagcggtcaggaatgacagaaacaagaaga
agaaggagccttcgaagcaggagtgcacggagagctacgagatgacggcagagctggacg
acctcaccgagaagatccgcaaggctcaccaggaaaccttcccctcgctctgccagctgg
gcaagtacaccacgaattccagcgctgaccatcgagtccggctggacctgggcctctggg
acaaattcagtgagctggccaccaagtgcattattaagatcgtggagtttgccaaacgcc
tgccaggtttcaccggcctgaccatcgcagaccagatcaccctgctgaaggccgcctgcc
tcgacatcctgattctcagaatctgcaccaggtacaccccagagcaagacactatgacgt
tttcggacggcctgaccctgaatcgaacccagatgcacaacgccggctttggccctttga
ctgacctggtgttcaccttcgccggccagctcctgccgctggagatggacgacgcggaga
ccggccttctcagcgccatctgcctgatctgtggagatcgtcaggaccttgaggaaccaa
caaaagtagataagctacaagaaccactgctggaagcaca

DBGET integrated database retrieval system