KEGG   Bos taurus (cow): 617357Help
Entry
617357            CDS       T01008                                 

Gene name
MYL10
Definition
myosin, light chain 10, regulatory
Orthology
K12756  
myosin regulatory light chain 10
Organism
bta  Bos taurus (cow)
Pathway
Focal adhesion
Tight junction
Leukocyte transendothelial migration
Regulation of actin cytoskeleton
Class
Cellular Processes; Cell motility; Regulation of actin cytoskeleton [PATH:bta04810]
Cellular Processes; Cell communication; Focal adhesion [PATH:bta04510]
Cellular Processes; Cell communication; Tight junction [PATH:bta04530]
Organismal Systems; Immune system; Leukocyte transendothelial migration [PATH:bta04670]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
Position
25
AA seq 172 aa AA seqDB search
MGAPRRARKKAEGGASSNVFSMFDQSQIQEFKEAFTIMDQNRDGFIDKEDLRDTFAAPGW
VSGRINVKNEELEAMVKEAPGPINFTVFLTMFGEKLKGTDPEETILHAFKVFDTEGKGFV
KADFIKEKLMTQADRFSEEEVKQMFAAFPPDVCGNLDYRNLCYVITHGEEKD
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
atgggggcacccagaagagcccggaaaaaagcagaaggaggagccagctccaacgtcttc
tccatgtttgatcagtcccagatccaggagtttaaagaggccttcaccatcatggaccaa
aaccgggatggcttcatcgacaaggaggacctgagggacacctttgctgctcctgggtgg
gtgtccggccgcatcaatgtaaagaacgaggagctggaggccatggtgaaggaggcccct
gggcccatcaacttcactgtcttcctgaccatgtttggggagaagctgaagggtacagac
cccgaggagaccatcctccacgccttcaaggtgttcgacactgaagggaaaggtttcgtc
aaggctgatttcatcaaagagaagctcatgacgcaggcagaccggttcagtgaggaggag
gtcaagcagatgtttgccgctttcccgccagatgtgtgtggcaatctggactacaggaac
ctgtgttacgtcatcacacatggtgaagagaaggactag

DBGET integrated database retrieval system