KEGG   Bos taurus (cow): 617419Help
Entry
617419            CDS       T01008                                 

Gene name
SCD5
Definition
stearoyl-CoA desaturase 5 (EC:1.14.19.1)
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
bta  Bos taurus (cow)
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
PPAR signaling pathway
AMPK signaling pathway
Brite
KEGG Orthology (KO) [BR:bta00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    617419 (SCD5)
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    617419 (SCD5)
 Environmental Information Processing
  Signal transduction
   04152 AMPK signaling pathway
    617419 (SCD5)
 Organismal Systems
  Endocrine system
   03320 PPAR signaling pathway
    617419 (SCD5)
Enzymes [BR:bta01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     617419 (SCD5)
Lipid biosynthesis proteins [BR:bta01004]
 Desaturase
  First
   617419 (SCD5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
Ensembl: 
UniProt: 
Position
6
AA seq 335 aa AA seqDB search
MPGPAVDAEKVPFRSAKEEIRAGVGVEGSEGGGGGGGRERPGARGHRQDIVWRNVFLMSL
LHLAAVYSLVLIPKAQPLTLLWAYFCFLLTALGVTAGAHRLWSHRSYKAKLPLRIFLAAA
NSMAFQNDIFEWSRDHRVHHKYSETDADPHNARRGFFFSHIGWLFVRKHRDVIEKGRKLD
VTDLLADPVVRFQRKYYKITVVLMCFVVPTLVPWYIWGESLWNSYFLASILRYTISLNVT
WLVNSVAHMYGNRPYDKHISPRQNPLVTLGAIGEGFHNYHHTFPFDYSASEFGLNFNPTT
WFIDFMCWLGLATDRKRATKQMIEARKARTGDGSA
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgccaggcccggccgtggacgcggagaaggtccccttccgcagcgccaaggaggagatc
cgtgcgggggtaggggtcgagggctcggagggcggcggcggcggcggcggccgggagagg
cccggcgcgcgcgggcaccggcaggacatcgtctggaggaacgtgttcctgatgagcctg
ctccacttggcggccgtgtactccctggtgctcatccccaaagcccagccgctcactctg
ctctgggcctacttctgcttcctcctgactgctctgggtgtgacagctggtgcccatcgt
ttgtggagccacaggtcctacaaggctaagctacccctgaggatatttctggctgctgcc
aactccatggctttccagaatgacatcttcgagtggtcgagggaccaccgagtccatcac
aagtactcggagacggacgctgacccacacaatgcccgccggggcttcttcttctcccac
atcggctggctgtttgtccgcaagcatcgggacgtcattgagaaggggaggaagcttgac
gttaccgacttgctggctgaccctgtggtccggttccagagaaagtactacaagatcacc
gtggtgctcatgtgcttcgtagtccccacgctggtgccctggtacatctggggagaaagc
ctgtggaactcctacttcctggcctccatcctccgctacaccatctcactcaacgtcacc
tggctggtgaacagtgtcgctcacatgtacggaaaccggccctatgacaagcacatcagc
cctcggcagaacccgctcgtcaccctgggtgccattggtgaaggtttccataactaccat
cacacctttccctttgactactctgcgagtgaatttggcttaaatttcaacccaaccacc
tggttcattgacttcatgtgttggctggggctagccactgaccgcaaacgggcaaccaag
cagatgatcgaagcccggaaagcccggactggagacgggagcgcctga

DBGET integrated database retrieval system