KEGG   Bos taurus (cow): 617585Help
Entry
617585            CDS       T01008                                 

Gene name
PPP3R2
Definition
(RefSeq) protein phosphatase 3 regulatory subunit B, beta
  KO
K06268  serine/threonine-protein phosphatase 2B regulatory subunit
Organism
bta  Bos taurus (cow)
Pathway
bta04010  MAPK signaling pathway
bta04020  Calcium signaling pathway
bta04022  cGMP-PKG signaling pathway
bta04114  Oocyte meiosis
bta04218  Cellular senescence
bta04310  Wnt signaling pathway
bta04360  Axon guidance
bta04370  VEGF signaling pathway
bta04380  Osteoclast differentiation
bta04625  C-type lectin receptor signaling pathway
bta04650  Natural killer cell mediated cytotoxicity
bta04658  Th1 and Th2 cell differentiation
bta04659  Th17 cell differentiation
bta04660  T cell receptor signaling pathway
bta04662  B cell receptor signaling pathway
bta04720  Long-term potentiation
bta04724  Glutamatergic synapse
bta04921  Oxytocin signaling pathway
bta04922  Glucagon signaling pathway
bta04924  Renin secretion
bta05010  Alzheimer's disease
bta05014  Amyotrophic lateral sclerosis (ALS)
bta05031  Amphetamine addiction
bta05152  Tuberculosis
bta05166  HTLV-I infection
bta05167  Kaposi's sarcoma-associated herpesvirus infection
Brite
KEGG Orthology (KO) [BR:bta00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    617585 (PPP3R2)
   04310 Wnt signaling pathway
    617585 (PPP3R2)
   04370 VEGF signaling pathway
    617585 (PPP3R2)
   04020 Calcium signaling pathway
    617585 (PPP3R2)
   04022 cGMP - PKG signaling pathway
    617585 (PPP3R2)
 Cellular Processes
  Cell growth and death
   04114 Oocyte meiosis
    617585 (PPP3R2)
   04218 Cellular senescence
    617585 (PPP3R2)
 Organismal Systems
  Immune system
   04625 C-type lectin receptor signaling pathway
    617585 (PPP3R2)
   04650 Natural killer cell mediated cytotoxicity
    617585 (PPP3R2)
   04660 T cell receptor signaling pathway
    617585 (PPP3R2)
   04658 Th1 and Th2 cell differentiation
    617585 (PPP3R2)
   04659 Th17 cell differentiation
    617585 (PPP3R2)
   04662 B cell receptor signaling pathway
    617585 (PPP3R2)
  Endocrine system
   04922 Glucagon signaling pathway
    617585 (PPP3R2)
   04921 Oxytocin signaling pathway
    617585 (PPP3R2)
   04924 Renin secretion
    617585 (PPP3R2)
  Nervous system
   04724 Glutamatergic synapse
    617585 (PPP3R2)
   04720 Long-term potentiation
    617585 (PPP3R2)
  Development
   04360 Axon guidance
    617585 (PPP3R2)
   04380 Osteoclast differentiation
    617585 (PPP3R2)
 Human Diseases
  Neurodegenerative diseases
   05010 Alzheimer's disease
    617585 (PPP3R2)
   05014 Amyotrophic lateral sclerosis (ALS)
    617585 (PPP3R2)
  Substance dependence
   05031 Amphetamine addiction
    617585 (PPP3R2)
  Infectious diseases
   05152 Tuberculosis
    617585 (PPP3R2)
   05166 HTLV-I infection
    617585 (PPP3R2)
   05167 Kaposi's sarcoma-associated herpesvirus infection
    617585 (PPP3R2)
Protein phosphatases and associated proteins [BR:bta01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     617585 (PPP3R2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EF-hand_1 EF-hand_6 EF-hand_5 EF-hand_7 EF-hand_8 SPARC_Ca_bdg EF-hand_4 EF-hand_9 YtfJ_HI0045
Motif
Other DBs
NCBI-GeneID: 617585
NCBI-ProteinID: NP_001073099
UniProt: Q2TBI5
Position
8
AA seq 170 aa AA seqDB search
MGNEASYPAEICSHFDEDEIKRLRKRFKKLDLDSSSALSVKEFTSMPELQENPLVQRVID
VFDTDGDGQVDFREFILGTSQFSVRGDEEQKLRFAFSIYDMDKDGYISNGELFQVLKMMV
GDNLKDWQLQQLVDKTIILLDKDGDGKISFQEFSAVVRSLEIHKHLVTIV
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
atgggaaatgaggccagttacccggcggagatatgctcgcacttcgacgaagatgaaatt
aaaaggctgcgcaagcgttttaagaagctggacttggacagttccagcgctctgagcgtc
aaagagttcacgtccatgccagagctgcaggagaacccgctggtgcagcgggtgatagac
gtcttcgacaccgacggcgacggacaggtggacttccgggaattcatcctggggacctcc
cagttcagcgtccggggagatgaggagcagaagctgaggtttgctttcagcatctacgac
atggacaaagacggctacatttccaacggggagctcttccaggtgctgaagatgatggta
ggcgacaacctgaaagactggcagttacagcagctggtggacaaaaccatcatcctcctg
gacaaagacggggacgggaaaatctccttccaggaattcagtgctgtggtcagaagcctg
gagatccacaagcacttggtgaccattgtgtga

DBGET integrated database retrieval system