KEGG   Bos taurus (cow): 617609Help
Entry
617609            CDS       T01008                                 

Gene name
POMT1
Definition
protein-O-mannosyltransferase 1 (EC:2.4.1.109)
Orthology
K00728  
dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
bta  Bos taurus (cow)
Pathway
Other types of O-glycan biosynthesis
Brite
KEGG Orthology (KO) [BR:bta00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    617609 (POMT1)
Enzymes [BR:bta01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.109  dolichyl-phosphate-mannose-protein mannosyltransferase
     617609 (POMT1)
Glycosyltransferases [BR:bta01003]
 O-Glycan biosynthesis
  O-linked Man type (Man a1- Ser/Thr)
   617609 (POMT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
Ensembl: 
UniProt: 
Position
11
AA seq 725 aa AA seqDB search
MLGFLQQPVMVTAEVNLNMVALTAVGLLSRLWQLAYPRAVVFDEVYYGQYISFYMKRIFF
LDGSGPPFGHMLLALGGYLGGFDGNFLWNRIGAEYSSNVPVWSLRLLPALSGALSVPMAY
EIVWELGFSHCAATGAALLLLIENALITQSRLMLLESVLIFFNLLAVLSYLKFCNSQKHR
PFSPRWWFWLVLTGVACSCAVGIKYVGVFTYLLVLGVAAVHAWHVIGDQTLSNVRVLCHL
LARAAALVVLPVLVYLLFFYIHLLLLCRSGPHDQIMSSAFQASLEGGLARVTQGQPLEVA
FGSQVTLKNVFGQPVPCWLHSHQSTYPMIYENGRGSSHQQQVTCYPFKDVNNWWIVKDPG
RHQLVVNNPPRPVRHGDVVQLVHGMTTRLLNTHDVAAPLSPHAQEVSCYIDYNISMPPQN
LWRLDIVNRESDTDVWKTILSEVRFVHVNTSAILKLSGVPLPDWGFRQLEVVGEKLFRGY
HESTVWNVEEHRYGRSQEQKERELELHSPTQVDISRNLSFMARFSELQWRMLTVRSDDSE
HKYSSTPLDWVMLDTNIAYWLHPRTSAQIHLLGNVVIWASASLATLVYALLFIWYLLRRR
RRVCDLPEDRWLRWVLAGALCAGGWAVNYLPFFLMEKTLFLYHYLPALTFQILLLPVVLE
HISDHLCRSQLQRSLFTALVVAWFTSACHVSNMLRPLTYGDRSLSPSELKALRWKDSWDI
LIRKY
NT seq 2178 nt NT seq  +upstreamnt  +downstreamnt
atgttggggttcttgcagcagcctgtgatggtgaccgctgaggtgaacttgaatatggta
gctctgaccgcggtgggattgctgagccgactatggcagcttgcctatccaagggccgtg
gtttttgatgaagtgtattacgggcagtacatctctttttatatgaagcggatcttcttt
ttggatggcagtggaccaccgtttggccacatgcttttggccttgggaggttatttagga
ggattcgatggtaactttctgtggaacagaattggagcagaatacagcagcaatgtgccc
gtgtggtccctgcgcctgctgccggccctttcgggggccctgtcggtgcccatggcctat
gagatcgtgtgggagctcggcttctctcactgtgccgccacgggggctgctctgctgctg
ttgattgagaacgctctcatcactcagtcaaggttaatgcttttggaatcagtgctgata
tttttcaatctgttggccgtgctgtcttacctgaagttctgcaactcccagaaacacagg
cccttctccccgagatggtggttttggttggtgctgacaggcgtggcctgctcctgtgca
gttggcatcaagtacgtgggtgtgttcacatacttgctggtgctcggggttgctgccgtc
cacgcctggcacgtgataggagaccagacgctgtcaaacgtccgtgtgctctgccacctg
ctcgcccgagcagcagccctggtggtgctcccggtcctggtgtacctgctgttcttctac
atccacctgctgctgctctgccgctccgggccccacgaccagatcatgtccagtgccttc
caggccagcctggagggggggctggcaagggtcacacaaggtcagcctctggaggtggcc
ttcggttcccaggtcaccctgaagaatgtctttggccaacccgtgccctgctggcttcac
tctcaccagagcacctaccctatgatatatgagaatggccgtggcagctcccaccagcag
caggtgacctgctaccccttcaaggatgtcaacaactggtggattgtcaaggaccccggg
aggcaccagctggtggtgaacaaccccccgaggcccgtgcggcacggcgacgttgtgcaa
ctggtgcacggcatgaccacccgcctcctcaacacgcatgatgtcgcagcccccctgagc
ccccacgcgcaggaggtttcctgctacattgactacaatatctccatgcccccccagaac
ctctggcggctggacatcgtgaacagggagtcggacacggatgtctggaagaccatcttg
tcagaggtccgctttgtacacgtgaacacctcggccatcctcaagctgagtggagtgccc
ctcccggactggggctttcggcagctggaagtggttggggagaagctgtttcggggctac
cacgagagcactgtgtggaacgtggaggagcaccgctacggcaggagccaggagcagaag
gagagggagctggagctgcactcccccacccaggtggacatcagcaggaacctcagcttc
atggccagattctccgagcttcagtggcggatgctgacggtgagaagtgacgattcggaa
cacaagtacagctccacgccgctggactgggtcatgctggacaccaacatcgcttactgg
ctgcaccccaggaccagtgcgcagatccacctgcttgggaacgtcgtgatctgggcctcc
gccagccttgccaccctggtgtacgccctgctgttcatctggtacctgctcagacgcaga
aggagagtctgcgacctccctgaagaccgctggctgcgctgggtgctggccggggctctg
tgcgccgggggctgggctgtgaactacctgcctttcttcctgatggagaagacgctcttc
ctctaccactacctgccggcgctcaccttccagatcctgctgctgcccgtggtcctggag
cacatcagcgaccacctgtgcaggtcccagctccaaaggagcctcttcacggccctggtc
gtcgcatggttcacctctgcctgtcacgtgtcgaacatgctgcgcccgctgacctatggg
gacaggtcgctgtcacccagtgagctcaaggcccttcgctggaaagacagctgggatatc
ctgatccggaaatactag

DBGET integrated database retrieval system