KEGG   Bos taurus (cow): 617701Help
Entry
617701            CDS       T01008                                 

Gene name
BDNF
Definition
brain-derived neurotrophic factor
Orthology
K04355  
brain-derived neurotrophic factor
Organism
bta  Bos taurus (cow)
Pathway
MAPK signaling pathway
Neurotrophin signaling pathway
Huntington's disease
Cocaine addiction
Alcoholism
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:bta04010]
Organismal Systems; Nervous system; Neurotrophin signaling pathway [PATH:bta04722]
Human Diseases; Neurodegenerative diseases; Huntington's disease [PATH:bta05016]
Human Diseases; Substance dependence; Cocaine addiction [PATH:bta05030]
Human Diseases; Substance dependence; Alcoholism [PATH:bta05034]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
Ensembl: 
UniProt: 
Position
15
AA seq 250 aa AA seqDB search
MTILFLTMVISYFGCMKAAPMKEANLRAQGSLAYPGVRTHGTLESMNGPKVGSRGLTSSS
SLADTFEHVIEELLDEDQKVRPSEENNKDADMYTSRVMLSSQVPLEPPLLFLLEEYKNYL
DAANMSMRVRRHSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQL
KQYFYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKRIGWRFIRIDTSC
VCTLTIKRGR
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgaccatccttttccttactatggttatttcatacttcggttgcatgaaggctgccccc
atgaaagaagccaacctccgagcccaaggcagcttggcctacccaggtgtgcggacccat
gggactctggagagcatgaatgggcccaaggtgggttcaagaggcctgacgtcctcgtcg
tcgttggctgacacttttgaacacgtgatcgaagagctgttggacgaggaccagaaagtt
cggcccagcgaggaaaacaataaagacgcggacatgtacacgtcccgggtgatgctcagc
agtcaagtgcctttggagccccctctcctcttcctgctcgaggaatacaaaaattacctg
gatgccgcaaacatgtccatgagggtccggcgccactcggaccccgcccgccgcggggag
ctgagcgtgtgtgacagcatcagcgagtgggtgaccgcagcggataaaaagactgcagtg
gacatgtcgggcgggacggtcacggtccttgaaaaagtccccgtctcaaaaggccagctg
aagcagtacttctacgagaccaagtgcaatcccatgggttacacgaaggagggctgcagg
ggcatagacaagaggcattggaactcccagtgccgaactacccagtcgtacgtgcgggcc
ctcaccatggatagcaaaaagcgtattggctggcggttcatacggatagacacttcttgt
gtatgtacactgaccattaagaggggaagatag

DBGET integrated database retrieval system