KEGG   Bos taurus (cow): 617701Help
Entry
617701            CDS       T01008                                 

Gene name
BDNF
Definition
brain-derived neurotrophic factor
Orthology
K04355  
brain-derived neurotrophic factor
Organism
bta  Bos taurus (cow)
Pathway
MAPK signaling pathway
cAMP signaling pathway
Neurotrophin signaling pathway
Huntington's disease
Cocaine addiction
Alcoholism
Brite
KEGG Orthology (KO) [BR:bta00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    617701 (BDNF)
   04024 cAMP signaling pathway
    617701 (BDNF)
 Organismal Systems
  Nervous system
   04722 Neurotrophin signaling pathway
    617701 (BDNF)
 Human Diseases
  Neurodegenerative diseases
   05016 Huntington's disease
    617701 (BDNF)
  Substance dependence
   05030 Cocaine addiction
    617701 (BDNF)
   05034 Alcoholism
    617701 (BDNF)
Cytokines [BR:bta04052]
 PDGF family
  Cysteine-knot growth factors
   Subclass II
    617701 (BDNF)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
Ensembl: 
UniProt: 
Position
15
AA seq 250 aa AA seqDB search
MTILFLTMVISYFGCMKAAPMKEANLRAQGSLAYPGVRTHGTLESMNGPKVGSRGLTSSS
SLADTFEHVIEELLDEDQKVRPSEENNKDADMYTSRVMLSSQVPLEPPLLFLLEEYKNYL
DAANMSMRVRRHSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQL
KQYFYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKRIGWRFIRIDTSC
VCTLTIKRGR
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgaccatccttttccttactatggttatttcatacttcggttgcatgaaggctgccccc
atgaaagaagccaacctccgagcccaaggcagcttggcctacccaggtgtgcggacccat
gggactctggagagcatgaatgggcccaaggtgggttcaagaggcctgacgtcctcgtcg
tcgttggctgacacttttgaacacgtgatcgaagagctgttggacgaggaccagaaagtt
cggcccagcgaggaaaacaataaagacgcggacatgtacacgtcccgggtgatgctcagc
agtcaagtgcctttggagccccctctcctcttcctgctcgaggaatacaaaaattacctg
gatgccgcaaacatgtccatgagggtccggcgccactcggaccccgcccgccgcggggag
ctgagcgtgtgtgacagcatcagcgagtgggtgaccgcagcggataaaaagactgcagtg
gacatgtcgggcgggacggtcacggtccttgaaaaagtccccgtctcaaaaggccagctg
aagcagtacttctacgagaccaagtgcaatcccatgggttacacgaaggagggctgcagg
ggcatagacaagaggcattggaactcccagtgccgaactacccagtcgtacgtgcgggcc
ctcaccatggatagcaaaaagcgtattggctggcggttcatacggatagacacttcttgt
gtatgtacactgaccattaagaggggaagatag

DBGET integrated database retrieval system