KEGG   Bos taurus (cow): 617701Help
Entry
617701            CDS       T01008                                 

Gene name
BDNF
Definition
(RefSeq) brain derived neurotrophic factor
  KO
K04355  brain-derived neurotrophic factor
Organism
bta  Bos taurus (cow)
Pathway
bta04010  MAPK signaling pathway
bta04014  Ras signaling pathway
bta04024  cAMP signaling pathway
bta04151  PI3K-Akt signaling pathway
bta04722  Neurotrophin signaling pathway
bta05016  Huntington's disease
bta05030  Cocaine addiction
bta05034  Alcoholism
Brite
KEGG Orthology (KO) [BR:bta00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    617701 (BDNF)
   04010 MAPK signaling pathway
    617701 (BDNF)
   04024 cAMP signaling pathway
    617701 (BDNF)
   04151 PI3K-Akt signaling pathway
    617701 (BDNF)
 Organismal Systems
  Nervous system
   04722 Neurotrophin signaling pathway
    617701 (BDNF)
 Human Diseases
  Neurodegenerative diseases
   05016 Huntington's disease
    617701 (BDNF)
  Substance dependence
   05030 Cocaine addiction
    617701 (BDNF)
   05034 Alcoholism
    617701 (BDNF)
Cytokines and growth factors [BR:bta04052]
 Growth factors
  Growth factors (RTK binding)
   617701 (BDNF)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NGF Spaetzle
Motif
Other DBs
NCBI-GeneID: 617701
NCBI-ProteinID: NP_001040072
BGD-bta: BT12389
Ensembl: ENSBTAG00000008134
UniProt: Q95106
Position
15
AA seq 250 aa AA seqDB search
MTILFLTMVISYFGCMKAAPMKEANLRAQGSLAYPGVRTHGTLESMNGPKVGSRGLTSSS
SLADTFEHVIEELLDEDQKVRPSEENNKDADMYTSRVMLSSQVPLEPPLLFLLEEYKNYL
DAANMSMRVRRHSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQL
KQYFYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKRIGWRFIRIDTSC
VCTLTIKRGR
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgaccatccttttccttactatggttatttcatacttcggttgcatgaaggctgccccc
atgaaagaagccaacctccgagcccaaggcagcttggcctacccaggtgtgcggacccat
gggactctggagagcatgaatgggcccaaggtgggttcaagaggcctgacgtcctcgtcg
tcgttggctgacacttttgaacacgtgatcgaagagctgttggacgaggaccagaaagtt
cggcccagcgaggaaaacaataaagacgcggacatgtacacgtcccgggtgatgctcagc
agtcaagtgcctttggagccccctctcctcttcctgctcgaggaatacaaaaattacctg
gatgccgcaaacatgtccatgagggtccggcgccactcggaccccgcccgccgcggggag
ctgagcgtgtgtgacagcatcagcgagtgggtgaccgcagcggataaaaagactgcagtg
gacatgtcgggcgggacggtcacggtccttgaaaaagtccccgtctcaaaaggccagctg
aagcagtacttctacgagaccaagtgcaatcccatgggttacacgaaggagggctgcagg
ggcatagacaagaggcattggaactcccagtgccgaactacccagtcgtacgtgcgggcc
ctcaccatggatagcaaaaagcgtattggctggcggttcatacggatagacacttcttgt
gtatgtacactgaccattaagaggggaagatag

DBGET integrated database retrieval system