KEGG   Bos taurus (cow): 617899Help
Entry
617899            CDS       T01008                                 

Gene name
POLD4
Definition
polymerase (DNA-directed), delta 4
Orthology
K03505  
DNA polymerase delta subunit 4
Organism
bta  Bos taurus (cow)
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Base excision repair
Nucleotide excision repair
Mismatch repair
Homologous recombination
HTLV-I infection
Module
DNA polymerase delta complex
Brite
KEGG Orthology (KO) [BR:bta00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    617899 (POLD4)
   00240 Pyrimidine metabolism
    617899 (POLD4)
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    617899 (POLD4)
   03410 Base excision repair
    617899 (POLD4)
   03420 Nucleotide excision repair
    617899 (POLD4)
   03430 Mismatch repair
    617899 (POLD4)
   03440 Homologous recombination
    617899 (POLD4)
 Human Diseases
  Infectious diseases
   05166 HTLV-I infection
    617899 (POLD4)
DNA repair and recombination proteins [BR:bta03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     DNA polymerase delta complex
      617899 (POLD4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
Ensembl: 
UniProt: 
Position
29
AA seq 107 aa AA seqDB search
MGRKRLITDSYPVVKRREGSAGHSKGELAPDLGEEPLPLSVDEEELELLRQFDLAWQYGP
CTGITRLQRWHRAEQMGLKPPPEVHQVLQSHPGDPRFQCSLWHFYPL
NT seq 324 nt NT seq  +upstreamnt  +downstreamnt
atgggccggaaacggctcatcactgactcctaccctgtagtgaagaggagggagggctcc
gctgggcacagcaagggggagctggcaccagatctaggggaagagcccctacccctgagc
gtggatgaagaggagctggagctgctgaggcagtttgacctggcctggcagtacgggccc
tgcacagggatcacacggttgcagcgctggcatcgggcagagcagatgggcttgaagcct
cccccagaagtgcatcaggtgctgcagagccaccccggggatccccgcttccagtgcagc
ctctggcatttctacccgctctga

DBGET integrated database retrieval system