KEGG   Bos taurus (cow): 617899Help
Entry
617899            CDS       T01008                                 

Gene name
POLD4
Definition
(RefSeq) DNA polymerase delta 4, accessory subunit
  KO
K03505  DNA polymerase delta subunit 4
Organism
bta  Bos taurus (cow)
Pathway
bta00230  Purine metabolism
bta00240  Pyrimidine metabolism
bta01100  Metabolic pathways
bta03030  DNA replication
bta03410  Base excision repair
bta03420  Nucleotide excision repair
bta03430  Mismatch repair
bta03440  Homologous recombination
bta05166  HTLV-I infection
Module
bta_M00262  DNA polymerase delta complex
Brite
KEGG Orthology (KO) [BR:bta00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    617899 (POLD4)
   00240 Pyrimidine metabolism
    617899 (POLD4)
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    617899 (POLD4)
   03410 Base excision repair
    617899 (POLD4)
   03420 Nucleotide excision repair
    617899 (POLD4)
   03430 Mismatch repair
    617899 (POLD4)
   03440 Homologous recombination
    617899 (POLD4)
 Human Diseases
  Infectious diseases
   05166 HTLV-I infection
    617899 (POLD4)
DNA replication proteins [BR:bta03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   DNA polymerase delta complex
    617899 (POLD4)
DNA repair and recombination proteins [BR:bta03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     DNA polymerase delta complex
      617899 (POLD4)
   MMR (mismatch exicision repair)
    DNA polymerase delta complex
     617899 (POLD4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_pol_delta_4 RepB
Motif
Other DBs
NCBI-GeneID: 617899
NCBI-ProteinID: NP_001069949
BGD-bta: BT27255
Ensembl: ENSBTAG00000017951
UniProt: Q3T0X9
Position
29
AA seq 107 aa AA seqDB search
MGRKRLITDSYPVVKRREGSAGHSKGELAPDLGEEPLPLSVDEEELELLRQFDLAWQYGP
CTGITRLQRWHRAEQMGLKPPPEVHQVLQSHPGDPRFQCSLWHFYPL
NT seq 324 nt NT seq  +upstreamnt  +downstreamnt
atgggccggaaacggctcatcactgactcctaccctgtagtgaagaggagggagggctcc
gctgggcacagcaagggggagctggcaccagatctaggggaagagcccctacccctgagc
gtggatgaagaggagctggagctgctgaggcagtttgacctggcctggcagtacgggccc
tgcacagggatcacacggttgcagcgctggcatcgggcagagcagatgggcttgaagcct
cccccagaagtgcatcaggtgctgcagagccaccccggggatccccgcttccagtgcagc
ctctggcatttctacccgctctga

DBGET integrated database retrieval system