KEGG   Bos taurus (cow): 618278Help
Entry
618278            CDS       T01008                                 

Gene name
COMT
Definition
catechol-O-methyltransferase (EC:2.1.1.6)
Orthology
K00545  
catechol O-methyltransferase [EC:2.1.1.6]
Organism
bta  Bos taurus (cow)
Pathway
Steroid hormone biosynthesis
Tyrosine metabolism
Metabolic pathways
Dopaminergic synapse
Class
Metabolism; Lipid metabolism; Steroid hormone biosynthesis [PATH:bta00140]
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:bta00350]
Organismal Systems; Nervous system; Dopaminergic synapse [PATH:bta04728]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
UniProt: 
Position
17
AA seq 272 aa AA seqDB search
MLEAPPLLLVAGGVGLALLALRWLATTDLQFFGRAFIVWNEFIMKPIRNLLMGSSKEQRI
LQHVLQHAVAGDPQSVVAAIDSYSLEKEWAMHVGEKKGQIVDRVLREQQPSVLLELGAYC
GYSAVRMARLLLPGARLLTIEFNPDYAAITQRMVEFAGLQDKVTVVLGASQDIIPQLKKK
YDVDTLDMVFLDHWKDRYLPDMLLLEECGLLREGTVLLADNVIYPGAPDFLEYVRGNSRF
ECSHFSSYLEYSKVVDGLEKVVYKGLSGPARP
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgctggaggccccgcccctgctgctggtcgctggtggcgtaggcctggccctgctcgcg
ctgcggtggctggccacaacggacctgcagttcttcggccgggcctttatcgtctggaac
gagttcatcatgaagcccatccgcaacctcctcatgggcagcagcaaggagcagcgcatc
ctgcagcacgtgctgcagcacgcggtggccggggacccgcagagcgtggtggccgccatc
gacagctacagcttggagaaggagtgggccatgcacgtgggcgagaagaaaggccagatc
gtggacagggtgctgagggaacagcagccgtccgtactgctggagctgggcgcctactgc
ggctactcggcagtgcgaatggcccgcctgctgctgcccggcgcccggctgctcaccatc
gagttcaatcccgactatgccgccatcacccagcggatggtggagtttgcaggcctgcag
gacaaggtcaccgttgttcttggagcatcccaggacatcatcccccagctgaagaagaaa
tacgatgtggacaccctggacatggtctttctcgaccactggaaggaccgctacctgccg
gacatgcttctcctggaggagtgcggcctgctgcgggaggggacagtgttgctggctgac
aacgtcatctaccctggggcgcccgactttctggagtacgtgcgcgggaacagccgcttc
gaatgttcgcacttcagctcgtacctggagtactccaaggtggtggacggcttggagaag
gtcgtctacaagggcctgagcggccctgctcggccctga

DBGET integrated database retrieval system