KEGG   Bos taurus (cow): 618571Help
Entry
618571            CDS       T01008                                 

Gene name
HEXB
Definition
hexosaminidase B (beta polypeptide) (EC:3.2.1.52)
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
bta  Bos taurus (cow)
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Glycosaminoglycan degradation
Glycosphingolipid biosynthesis - globo series
Glycosphingolipid biosynthesis - ganglio series
Metabolic pathways
Lysosome
Module
Keratan sulfate degradation
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:bta00520]
Metabolism; Glycan biosynthesis and metabolism; Glycosaminoglycan degradation [PATH:bta00531]
Metabolism; Glycan biosynthesis and metabolism; Glycosphingolipid biosynthesis - globo series [PATH:bta00603]
Metabolism; Glycan biosynthesis and metabolism; Glycosphingolipid biosynthesis - ganglio series [PATH:bta00604]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:bta00511]
Cellular Processes; Transport and catabolism; Lysosome [PATH:bta04142]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
20
AA seq 537 aa AA seqDB search
MEQRGLARLRLPGLLALLAALAARTPRVSASGDLNLWPLPVSLKTTPRLFYLSPGNFFFG
HSPTSKAGPSCAVLQEAFRRYYDYIFGFYKWHHGHNKIPSEMELQKLEVSVIMDPECDSF
PSITSDESYTLLVKGPVATLTANRVWGVLRGLETFSQLIYQDSYGTFTANESNIVDSPRF
PHRGILIDTSRHFLPVKTILKTLDAMAFNKFNVLHWHIVDDQSFPYQSISFPELSNKGSY
SLSHVYTPNDVRTVIEYARLRGIRVLPEFDSPGHTESWGKGQKDLLTPCYHAREPSGTFG
PINPILNSTYSFLSKLFKEISTVFPDEFIHLGGDEVNFNCWESNPAVLNFMMNKGFGKNF
KKLQSFYMQMVLDMISTMKKRSIVWQEVYDDEGKLLPGTVVQVWKMGDFYKELENITAAG
FPVIISAPWYLDVINYGQDWRQYYSVKPLNFAGTPEQKQLVIGGEACIWGEYVDATNLTP
RLWPRASAVGERLWSPQEVTDLDDAYRRLTRHRCRMVRRGIAAQPLFTGYCEHEGRM
NT seq 1614 nt NT seq  +upstreamnt  +downstreamnt
atggagcagcgcgggctggcgaggctgagactacccgggctgctggcgctgctggcggcg
ctggcggcgcggaccccgcgcgtttctgcttcgggagacctgaatctttggcccctccct
gtctctctgaagacgaccccgcgcttgttttacctctcgcccggaaacttcttcttcggg
cacagccccacttccaaggctggcccctcctgcgcagtcctgcaggaagcgtttcggcga
tattatgactatatttttggtttctacaagtggcatcatggccataataaaattccaagt
gaaatggagttacagaaacttgaagtctctgtcatcatggacccagagtgtgacagtttc
cccagcatcacttcagatgagtcttatactttactggtgaaaggaccagtggccacgctc
actgccaacagggtttggggagtattacgaggtttagagacctttagccagttgatttat
caagattcttacgggactttcactgccaatgaatccaacattgtggattctcccaggttt
cctcatagaggaatcttaattgatacatctagacactttctgcctgttaagactattttg
aaaactctggatgccatggcttttaataagtttaatgttctccactggcacatagtggat
gaccagtctttcccttatcagagcatcagttttcctgaattaagcaataaaggaagctat
tctttgtctcatgtgtatacaccaaacgatgtccgtacagtgattgaatatgcccgatta
cgagggattcgcgtcctgccagaatttgatagccctggacatacggagtcttggggaaaa
ggccagaaagacctcctgactccatgttatcatgcgagagagccatctgggacttttgga
cctataaaccctatattgaattcaacttacagcttcctgtctaaacttttcaaagaaatt
agtactgtgtttccagatgaattcattcatctgggaggagatgaagtaaattttaattgt
tgggagtccaatccagcagtcctgaatttcatgatgaacaaaggctttggcaaaaatttt
aagaaactacaatctttctatatgcagatggttttggatatgatttcaaccatgaagaag
agatccatagtctggcaagaggtttatgatgatgaaggcaagcttctaccaggcacagta
gttcaagtgtggaaaatgggcgacttctataaggaactagagaacattacagcagctggc
ttccctgtgatcatttctgctccttggtacttagacgtaatcaattatgggcaagactgg
agacagtactactctgtgaagcctcttaactttgcaggtactccggaacagaaacagctc
gtcattggtggagaagcctgcatatggggagagtatgtggatgcaactaaccttactcca
agattatggcctcgggcgagtgctgttggtgagagactctggagtccccaggaagtcaca
gacctagatgatgcctacaggaggctaacaagacaccgctgcagaatggtcagacgagga
atagctgcacaacctctctttactggatattgtgagcatgagggcagaatgtaa

DBGET integrated database retrieval system