KEGG   Bos taurus (cow): 618605Help
Entry
618605            CDS       T01008                                 

Gene name
SPHK1
Definition
sphingosine kinase 1
Orthology
K04718  
sphingosine kinase [EC:2.7.1.91]
Organism
bta  Bos taurus (cow)
Pathway
Sphingolipid metabolism
Metabolic pathways
Calcium signaling pathway
VEGF signaling pathway
Fc gamma R-mediated phagocytosis
Tuberculosis
Module
Sphingosine degradation
Brite
KEGG Orthology (KO) [BR:bta00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    618605 (SPHK1)
 Environmental Information Processing
  Signal transduction
   04370 VEGF signaling pathway
    618605 (SPHK1)
   04020 Calcium signaling pathway
    618605 (SPHK1)
 Organismal Systems
  Immune system
   04666 Fc gamma R-mediated phagocytosis
    618605 (SPHK1)
 Human Diseases
  Infectious diseases
   05152 Tuberculosis
    618605 (SPHK1)
Enzymes [BR:bta01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.91  sphinganine kinase
     618605 (SPHK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
Position
19
AA seq 475 aa AA seqDB search
MLGSPIRMGSPRPVYTAKLLSDPATAGNDAGAPTAPATGGEGEPHSRHREARLGSTDKEL
KSGAAAADSVRTAPGTPRQRGEVMDAAGGSRNTLPRPCHVLVLLNPRGGKGKALQLFRSH
VQPLLAQADVSFTLMLTERRNHARELVRAEDLRRWDALVVMSGDGLIHEVVNGLMERPDW
ETAIQKPLCSLPAGSGNAVAASLNYYAGYEQVTKEDLLTNCTQLLCRRLLAPMDLLSLQT
ACGQRLFSVLSLAWGFIADVDLESEKFRRLGEMRFTLGACLRLVALRTYRGSLAYLPAET
LASRRGPSPALAPQDPADTHVVPXEQPVPPHWTVVPEQDFVLVLALLHSHLASDLFTAPM
GRCSAGAMHLFYVRAGVSRAMLLRLFLAMEKGRHMECHCPHLVYVPVVAFRLEPKDGKGV
FTVDGELLISEAVQGQVLPNYFWMVSGYREPPPSLKPQPSPRRKSQQTLPPSERP
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgcttggctccccaatccggatggggtcgcctaggcctgtttacaccgccaagctcctt
tcagatccggcaaccgcagggaatgacgcgggtgcccccacagccccggcaacgggcggg
gagggcgagccccatagccgtcaccgagaggcccgcctgggcagcaccgataaggagctg
aagtcaggagccgccgcggcggacagcgtccggacggcgccggggacccctcggcagcgg
ggcgaggtcatggatgcagcgggcggctcccggaacacgctcccaaggccctgccacgtg
ctggtgttgttaaatccgcgcgggggcaagggcaaagccctgcagctcttcaggagccac
gtacagccgctgctggcccaggccgacgtctccttcacgctgatgctcactgagcggcgg
aaccacgcccgggagctggtgcgtgcggaggacctgagacgctgggacgcgctggtggtc
atgtccggagatgggctgatccacgaggtggtgaacgggctcatggagcggcctgactgg
gagaccgccatccagaagcccctgtgtagcctcccggcaggctctggcaatgcagtggcc
gcttctttgaactattacgccgggtacgagcaggtgactaaggaagacctcctgaccaac
tgcacgcagctgctgtgccgccggctgctggcgcccatggacctgctatccctgcagacc
gcctgcgggcagcgcctcttctctgtgctcagcctggcgtggggtttcatcgccgacgtg
gatctggagagcgagaagtttcggcgcctgggcgagatgcgcttcactctaggcgcctgc
ctgcgcctggtggccctgcgcacctaccggggcagcctggcctacctgcccgcagaaacg
ctggcttccaggaggggcccctccccggctctggccccgcaggaccccgcggacacccat
gtggtgcccntggagcagccagtgcctcctcactggacggtggtgccggagcaggacttt
gtgctggtgttagcactcctgcattcccacctggccagtgaccttttcaccgcccccatg
ggccgctgttcggctggcgccatgcatctgttctacgtgcgtgctggcgtgtcccgggcc
atgctgctgcgcctcttcctggccatggagaaaggcaggcacatggagtgccactgcccc
cacctggtctatgtgcctgtggttgccttccgcctggagcccaaggatgggaagggtgtg
tttactgtggatggggaactgctgatcagcgaggctgtccagggccaggttctccccaac
tacttctggatggtcagtggctacagagagcccccaccctctctgaaaccacagccctca
ccccgcaggaagtctcagcagacgctgcccccatcagagcgtccctga

DBGET integrated database retrieval system