KEGG   Bos taurus (cow): 767822Help
Entry
767822            CDS       T01008                                 

Gene name
PNPLA6
Definition
patatin-like phospholipase domain containing 6 (EC:3.1.1.5)
Orthology
K14676  
lysophospholipid hydrolase [EC:3.1.1.5]
Organism
bta  Bos taurus (cow)
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:bta00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    767822 (PNPLA6)
Enzymes [BR:bta01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     767822 (PNPLA6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
7
AA seq 1332 aa AA seqDB search
MDAPLQTGMVLGMMIGAGVAVLVTAVLILLLVRRLRVPKAPAPDGPRYRFRKRDKVLFYG
RKIMRKVSQSTSSLVDASVSTTSRPRMKKKLKMLNIAKKILRIQKEAPTLQRKEPPPAVL
EADLTEGDLANSHLPSEVLYMLKNVRVLGHFEKPLFLELCRHMVFQRLSQGDYVFRPGQP
DASIYVVQDGLLELCLPGPDGKECVVKEVVPGDSVNSLLSILDVITGHQHPQRTVSARAA
RDSTVLRLPVEAFSAVFTKYPESLVRVVQIIMVRLQRVTFLALHNYLGLTNELFSHEIQP
LRLFPSPGLPPRTSPVRGSKRMVSTVASEELRETPGRPSDPTGAPLPGTGGTQGDPVKPT
SLETSSAPLLSRCISMPVDISGLQGGPRSDFDMAYERGRISVSLQEEASGGFQAASARTP
SQEPREQPAGACEYSYCEDESASGSCPFGPYQGRQTSSIFEAAKQELAKLMQIEDPTLLN
SRVLLHHAKAGTIIARQGDQDVSLHFVLWGSLHVYQRMIDKAEDVCLFVVQPGELVGQLA
VLTGEPLIFTLRAQRDCTFLRISKSNFYEIMRAQPSVVLSAAQTVAARMSPFVRQMDFAI
DWTAVEAGRALYRQGDRSDCTYIVLNGRLRSVIQRGSGKKELVGEYGRGDLIGVVEALTR
QPRATTVHAVRDTELAKLPEGTLGHIKRRYPQVVTRLIHLLSQKILGNLQQLRGPFPGSG
LGVPPHSELTNPASNLSTVAVLPVCAEVPMVAFMLELQHALQAIGPTLLLNSDIIRARLG
ASALDSIQEFRLSGWLAQQEDTHRIVLYQTDTSLTPWTVRCLRQADCILIVGLGDQEPTL
GQLEQMLENTAVRALKQLVLLHREEGAGPTRTVEWLNMRSWCSGHLHLRCPRRLFSRRSP
AKLHELYEKVFSRRADRHSDFSRLARVLTGNTIALVLGGGGARGCSHIGVLKALEEAGVP
VDLVGGTSIGSFIGALYAEERSASRTKQRAREWAKSMTSVLEPVLDLTYPVTSMFTGSAF
NRSIHRVFQDKQIEDLWLPYFNVTTDITSSAMRVHKDGSLWRYVRASMTLSGYLPPLCDP
KDGHLLMDGGYINNLPADIARSMGAKTVIAIDVGSQDETDLSTYGDSLSGWWLLWKRLNP
WADKIKVPDMAEIQSRLAYVSCVRQLEVVKSSSYCEYLRPPIDCFKTMDFGKFDQIYDVG
YQYGSTVFGGWSRGDIIEKMLTDRWSADLNESRRADVLAFPSSGFTDLAEIVSRIEPPTT
SYVSVSDGCADGEESDCLTEYEEDAGPECSRDEGGSPEGASPSTALEMEEEKSILRHRRW
LPQEPSSPAADT
NT seq 3999 nt NT seq  +upstreamnt  +downstreamnt
atggacgccccgctgcaaaccggaatggtgctgggcatgatgatcggggctggagtcgcg
gttctggtcacggccgtgctcatcctgctgctggtgcggaggcttcgagtgccgaaagct
ccagccccggacggcccccgttaccgattccggaagagagacaaagtgcttttctatggc
cggaagatcatgcgaaaggtgtcacaatccacttcttccttagtggacgcctccgtctcc
accacttcccgcccacgcatgaagaagaaacttaagatgctcaacattgccaagaagatc
ctgcgcatccagaaagaggcgcccacgctgcagcggaaggagcccccgcctgctgtgctg
gaggctgacctgaccgagggcgacctggccaactcccacctgccctccgaggtgctctac
atgctcaagaatgtccgggtgctgggccactttgagaagccactcttcctggagctctgc
cgccacatggtcttccagcggctcagtcagggtgactatgtcttccgacctggccagccg
gatgcaagcatctatgtggtacaggatggactcctggagctctgtctgccggggcctgac
gggaaggagtgtgtggtgaaggaagtggttcctggggacagtgtcaacagcctcctgagc
atactggatgtcatcactggtcaccagcacccacagcgcactgtgtccgcccgggcagcc
cgagactccacggtgctgcggctgccggtggaggccttctcagcggtattcaccaagtac
cccgagagcctggtgcgggtggtgcagatcatcatggtgaggttgcagcgggtcactttc
ctggcactccacaactacctgggactgaccaatgagctcttcagccatgagatccagcca
ctgcgcctcttccctagcccgggcctcccaccccgcaccagcccagtgcgtggctccaag
cggatggtcagcactgtggcctcagaggagctgagggagacccctggccggccgtctgac
cccactggggccccactgcccgggactggaggtacccaaggggacccagtgaagcccaca
tccctggaaacctcctcagcccccttgctgagtcgctgcatctccatgccagtggatatc
tcaggcttgcagggtgggccccgctcagacttcgacatggcatatgaacggggccgaatc
tctgtgtccctgcaagaagaggcctcaggagggttccaggcagcctcagctcggactccc
agtcaggagccccgggagcagccagcaggcgcctgtgagtacagctattgtgaggacgag
tcggcctccggcagctgccccttcgggccctaccagggccgccagacaagcagcatcttt
gaggcagcaaagcaggagctggccaagctgatgcagattgaggaccccactcttctgaat
agtcgagttctgctacatcacgccaaagctggcaccatcatcgcccgccagggggaccag
gatgtgagcctgcactttgtgctgtggggcagtctgcacgtgtaccagcgcatgatcgac
aaggccgaggacgtgtgcctgttcgtggtacagcccggggagctagtgggacagttggct
gtgctcaccggcgagcccctcatcttcacgcttcgagcccagcgtgactgtaccttcctg
cggatctccaagtccaacttctacgagatcatgcgtgcacagcccagcgtggtgctgagc
gccgcacaaaccgtggccgccaggatgtcgcccttcgtgcgccagatggacttcgccatc
gactggacagcggtggaggcgggacgcgcactgtacaggcagggagaccgttcagactgc
acctacatcgtgctcaacgggcggctgcgtagtgtcattcagaggggcagcggcaaaaaa
gagctggtgggcgagtacggccgcggggatctcataggagtggtggaggcgctgacaagg
cagccacgtgccacgacggtgcacgcggtgcgcgacacagagctggccaaactccccgag
ggcaccctgggccacatcaaacgtcgatacccgcaggtcgtgacccgcctcatccacctg
ctgagtcagaagattctggggaatttgcagcagctgcgaggacccttcccaggctcggga
ctaggtgtaccccctcactcggagctcaccaaccccgccagcaacctgtcaacagtggca
gtgctgcctgtgtgtgccgaggtgcccatggtggccttcatgctggagctgcagcacgct
ctgcaagccattggccccacgctcctcctcaacagtgacatcatccgggcccgcctgggg
gcctctgcactggacagcatccaagaattccggctgtcagggtggctggcccagcaggag
gacacgcaccgcatcgtgctctaccaaacagacacatcgctgacgccctggactgtgcga
tgcctgcgtcaggccgactgcatcctcatcgtggggctgggcgaccaggagcccacactt
ggccagctggagcagatgctggagaacacggcagtgcgcgccctcaagcagctggttctg
ctgcaccgcgaggagggcgcaggccccacacgcactgtggagtggctcaacatgcgcagc
tggtgctcgggacacctgcatctgcgctgtccgcgccgcctcttctcacgccgcagcccg
gccaagctgcacgagctctacgagaaggttttctcgaggcgcgcagaccggcacagcgat
ttctcccgcctggcgcgggtgctcacgggcaacaccatcgccctggtgctgggcgggggc
ggagccaggggctgctcacacatcggggtgctgaaggcattagaggaggcgggggtcccc
gttgacctggtgggtggcacgtccatcggctccttcatcggggccctgtacgccgaggag
cggagcgccagccgcactaaacagcgggcccgggagtgggctaagagcatgacttcggtg
ctggagcccgtactggacctcacctaccccgtcacctccatgttcacggggtcagccttc
aaccgcagcatccaccgtgtcttccaggacaagcagatcgaggacctgtggctgccatac
ttcaacgtgaccacggatatcacctcctcagccatgcgtgtccacaaagatggctccctg
tggcgatacgtgcgtgccagcatgactctctcgggctacctgccgccgctgtgcgacccc
aaggatgggcacctcctcatggacggcggctacatcaacaacctgccagcggacatcgcc
cgcagcatgggtgccaagacagtcatcgccatcgacgtggggagccaggacgagacagac
cttagcacatacggggacagcctgtctggctggtggcttctgtggaagcggctgaatccc
tgggcagacaagatcaaggttccagatatggcagagatccagtctcgcctggcctacgtg
tcctgcgtgcgacagctggaggttgtgaagtccagctcctactgtgagtacctgcgccca
cccatcgactgcttcaagaccatggacttcgggaagttcgaccagatctatgatgtgggc
taccagtatggatcgaccgtctttgggggctggagccggggcgacatcattgaaaagatg
ctcacagaccggtggtctgccgacctgaacgagagccgccgtgcagacgtgctcgccttc
cccagctctggcttcaccgacttggcggagatagtgtcccggatcgagccgcccaccacg
agctacgtttcggtttccgacggttgtgctgatggggaggagtcggactgtctgacggag
tatgaggaggacgcgggccctgagtgctcacgggacgaagggggctctccggagggcgca
agccccagcactgccttggagatggaggaggagaagtcgatcctccggcaccggcgctgg
ctgccgcaggaaccctccagccctgctgcagatacctga

DBGET integrated database retrieval system