KEGG   Bos taurus (cow): 768005Help
Entry
768005            CDS       T01008                                 

Gene name
SLC9A3R2
Definition
solute carrier family 9 (sodium/hydrogen exchanger), member 3 regulator 2
Orthology
K13358  
Na(+)/H(+) exchange regulatory cofactor NHE-RF2
Organism
bta  Bos taurus (cow)
Pathway
Aldosterone-regulated sodium reabsorption
Brite
KEGG Orthology (KO) [BR:bta00001]
 Organismal Systems
  Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    768005 (SLC9A3R2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
Ensembl: 
UniProt: 
Position
25
AA seq 226 aa AA seqDB search
MARSGNAVPSAPAPGAPPQSPSRGLVQDTNGPLRELRPRLCHLRKGPQGYGFNLHSDKSR
PGQYIRSVDPGSPADHSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEAQLLVVDPE
TDEHFKRLRVTPTEEHVEGPLPSPVTNGTSSAQLNGGSVCSSRSDLPGLDKDTEDGSTWK
RDPFQESGLHLSPTAAEAKEKARATRVNKRAPQMDWNRKREIFSNF
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atggcccgctctgggaatgccgtgccatccgccccggccccgggagcccctccacagagc
ccgtctcgggggcttgtgcaggataccaacgggcccctgagggagctgcgcccaaggctc
tgccacctacggaagggcccccagggctacgggtttaacctgcacagcgacaagtcccgg
cccggacagtacatccgctcggtggaccccggctcccctgccgaccactcaggcctccgt
gcccaggaccgactcatagaggtgaacgggcagaatgtggaggggttgcgccatgcggag
gtggttgccagcatcaaggcgcgggaagacgaggcccagctgctggtggtggaccccgag
acggatgaacacttcaagcgactgcgggtcacacccaccgaggagcatgtggaaggtcca
ctgccatcgccggtcaccaacgggaccagctcggcccagctcaatggtggctccgtgtgc
tcatcccgaagtgacctgcccggcttagacaaggacactgaggatggcagcacgtggaag
cgagatccttttcaggagagcggccttcacctgagccccacggcagctgaggccaaggag
aaggcgagagccaccagggtcaacaagcgggcaccacagatggactggaaccggaagcgc
gagatcttcagcaacttctga

DBGET integrated database retrieval system