KEGG   Bos taurus (cow): 777776Help
Entry
777776            CDS       T01008                                 

Gene name
LYZ, LYS, LZ
Definition
lysozyme (EC:3.2.1.17)
Orthology
K13915  
lysozyme C [EC:3.2.1.17]
Organism
bta  Bos taurus (cow)
Pathway
Salivary secretion
Class
Organismal Systems; Digestive system; Salivary secretion [PATH:bta04970]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
Ensembl: 
UniProt: 
Position
5
AA seq 148 aa AA seqDB search
MKALLILGLLLFSVAVQGKVFERCELARSLKRFGMDNFRGISLANWMCLARWESNYNTQA
TNYNAGDQSTDYGIFQINSHWWCNDGKTPGAVNACHLPCGALLQDDITQAVACAKRVVSD
PQGIRAWVAWRSHCQNQDLTSYIQGCGV
NT seq 447 nt NT seq  +upstreamnt  +downstreamnt
atgaaggctctcctcattctggggcttctcctcttttcggtcgctgtccaaggcaaggtc
tttgagagatgtgagcttgccagaagtctgaaaagatttggaatggataactttagggga
atcagcctggcaaactggatgtgtttggccagatgggaaagcaattacaacacacaagct
acaaactacaatgctggagaccaaagcactgattatgggatatttcaaatcaatagccac
tggtggtgcaatgatggcaaaaccccaggagcagttaacgcctgtcatttaccctgcggt
gctttgctgcaagatgacatcactcaagctgtagcatgtgcaaagagggttgtcagtgat
ccacaaggcattagagcatgggtggcatggagaagtcattgtcaaaaccaagatctcacg
agttacattcagggttgtggagtgtaa

DBGET integrated database retrieval system