KEGG   Bos taurus (cow): 780933Help
Entry
780933            CDS       T01008                                 

Definition
cationic trypsin (EC:3.4.21.4)
Orthology
K01312  
trypsin [EC:3.4.21.4]
Organism
bta  Bos taurus (cow)
Pathway
Neuroactive ligand-receptor interaction
Pancreatic secretion
Protein digestion and absorption
Influenza A
Brite
KEGG Orthology (KO) [BR:bta00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    780933
 Organismal Systems
  Digestive system
   04972 Pancreatic secretion
    780933
   04974 Protein digestion and absorption
    780933
 Human Diseases
  Infectious diseases
   05164 Influenza A
    780933
Enzymes [BR:bta01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     780933
Peptidases [BR:bta01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   780933
Exosome [BR:bta04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   780933
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
Ensembl: 
UniProt: 
Structure
PDB: 
4I8H 4I8G 3MI4 3MFJ 4I8K 4I8J 4I8L 2XTT 1HJ9 2AYW 4NIV 1S0Q 1S0R 3NKK 2AH4 2AGI 3NK8 2UUY 2AGE 1UTN 1UTO 1UTQ 3PLB 4AB9 3UNR 1Y59 1J8A 4ABA 4ABB 4ABD 4ABH 2AGG 4HGC 4NIX 4ABE 4ABF 4NIW 2OXS 1O3D 5PTP 1P2J 4B2B 1C5S 1GI4 1C5T 1C5U 1C1P 1C1Q 1C1R 1C1T 1O2W 1O38 1GI2 1GHZ 3A8A 2ZQ2 1Y5A 1O3J 1O3L 1N6X 1N6Y 1C1N 1C1O 1C2H 1C2J 1C2M 1TPP 2G8T 1O2U 1O35 1GI0 1GI1 4B2C 3UWI 1O3K 1C5P 1C5Q 1GI3 4ABJ 3PMJ 2G5V 1O2R 1O2Y 1O37 1O2X 1O33 1O2P 1C5R 1C2I 1C5V 1GI6 3LJO 1O2I 1O2N 1O2Q 1O2V 1O34 1GJ6 1C2L 2BTC 1XUG 1XUI 1BTY 1TLD 2ZFS 2G5N 1O3I 4ABG 3PM3 3PLK 1O3H 3UPE 4ABI 3LJJ 3ITI 3GY4 3GY7 2G81 1O30 1O3F 1O3G 1O3M 1O3N 1O3O 2PTN 2PLX 2OTV 3GY2 3GY5 2FX6 2FI3 2FI4 2FI5 1O39 4AB8 3RXI 3RXK 3RXO 3RXP 3PWC 1Y5U 1Y3V 1V2L 1P2K 1GI5 3UNQ 2FTL 1V2O 1O2T 3V13 3PWB 3PLP 1O2K 1O2O 1C1S 3D65 1O3C 1O3E 2FX4 2FTM 1Y5B 1V2M 1P2I 1O2J 1O2S 1O2Z 1C2D 1C2E 1C2G 1C2K 1SFI 1TGN 1O31 2ZDK 3RXQ 3RXU 3RU4 2ZQ1 1O2L 3UOP 1O2M 4AOR 3T25 3T26 3RXA 3RXB 3RXC 3RXD 3RXE 3RXF 3RXG 3RXH 3RXJ 3RXL 3RXM 3RXT 3RXV 3Q00 3M7Q 3AAV 3GY3 3GY6 2O9Q 1Y3X 1TX8 1RXP 1V2R 1O36 1C2F 1JRT 1BTW 1BTX 1TPO 3PTB 1TGT 2TGT 3PTN 3ATI 3RXR 3ATM 1V2S 3RXS 3ATK 3ATL 3T29 3AAS 3A7T 3A7V 3A7W 3A7X 3A80 3A82 3A84 3A85 3A86 3A87 3A88 3A8B 3A8D 3GY8 1Y3Y 1TX7 1V2W 1O3B 3BTH 2ZFT 1O2H 4B1T 3A81 3A83 1O32 1F2S 4GUX 3V12 3UQO 3UNS 3AAU 3A7Z 3A89 2ZDL 1ZR0 1Y3U 1Y3W 1V2N 1V2U 1V2V 1G3B 1G3C 1G3D 1G3E 1F0T 1QCP 1QB9 1QB6 1SBW 1QB1 1QBO 1QBN 1QA0 3BTF 3BTM 1BJU 1BJV 1AZ8 1XUK 1TAW 1JRS 1MAX 1MAY 1TNG 1TNH 1TNJ 1TNK 1PPC 1NTP 1TGS 1TGC 2TGA 1TGB 3A7Y 2G55 3A8C 1EJM 3BTE 3BTK 4B2A 3V0X 1V2J 1V2T 1OYQ 1NC6 1K1P 1G36 1F0U 1CE5 2BZA 3BTD 3BTG 3BTQ 3BTT 1ZZZ 1XUF 1MTS 1MTU 1MTV 1MTW 1TPS 1TNI 1TNL 1TPA 2PTC 2TGP 3TPI 1V2P 1XUJ 2ZDM 2TIO 1TIO 3VPK 2ZHD 3T27 2ZDN 4J2Y 4AOQ 3PYH 2ILN 2D8W 1V2K 1OX1 1O3A 1K1N 1K1O 1JIR 1BTZ 1TYN 1PPE 1GBT 3BTW 3QK1 3UUZ 2A7H 1YP9 1YYY 1AUJ 1SMF 2TGD 3OTJ 3M35 1LQE 1K1I 1K1J 1K1M 1G9I 1XUH 1AQ7 1BTP 4TPI 3VEQ 2CMY 3RDZ 1V2Q 1OPH 1D6R 1TAB 3UQV 3I29 3E8L 2F3C 1K1L 2QYI 1EZX 2TLD 3T28 4NIY 2QN5 3UY9 1C9T 2J9N 2BY5 2BY6 2BY7 2BY8 2BY9 2BYA 2BLV 2BLW 1UTP 1EB2 1QL7 1QL8
Thumbnails

Jmol
Position
4
AA seq 246 aa AA seqDB search
MKTFIFLALLGAAVAFPVDDDDKIVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVS
AAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLN
SRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQIT
SNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIK
QTIASN
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgaagaccttcatctttctggctctcttgggagccgctgttgctttccccgtggacgat
gatgacaagatcgtgggcggctacacctgtggggcaaatactgtcccctaccaagtgtcc
ctgaactctggctaccacttctgcgggggctccctcatcaacagccagtgggtggtgtct
gcggctcactgctacaagtccggaatccaagtgcgtctgggagaagacaacattaatgtc
gttgagggcaatgagcaattcatcagcgcatccaagagtatcgtccatcccagctacaac
tcaaacaccttaaacaacgacatcatgctgattaaactgaaatcagctgccagtctcaac
agccgagtagcctctatctctctgccaacatcctgtgcctctgctggcacccagtgtctc
atctctggctggggcaacaccaaaagcagtggcaccagctaccctgatgtcctgaagtgt
ctgaaggctcccatcctatcagacagctcttgcaaaagtgcctacccaggccagatcacc
agcaacatgttctgtgcgggctacctggagggcggaaaggactcctgccagggtgactcc
ggtggccctgtggtctgcagtggaaagctccagggcattgtctcctggggctctggctgc
gctcagaaaaacaagcctggtgtctacaccaaggtctgcaactacgtgagctggattaag
cagaccatcgcctccaactaa

DBGET integrated database retrieval system